SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333901336|ref|YP_004475209.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333901336|ref|YP_004475209.1|
Domain Number 1 Region: 434-576
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.54e-32
Family Flavohemoglobin, C-terminal domain 0.0076
Further Details:      
 
Domain Number 2 Region: 331-431
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.21e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00075
Further Details:      
 
Domain Number 3 Region: 565-675
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-16
Family 2Fe-2S ferredoxin-related 0.023
Further Details:      
 
Domain Number 4 Region: 173-289
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000236
Family PNP-oxidase like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333901336|ref|YP_004475209.1|
Sequence length 688
Comment nitric oxide dioxygenase [Pseudomonas fulva 12-X]
Sequence
MTDLAKTPAPWHSGETFIQEKLGVAERMDAVGKRVVRDFMPDQHRDFYAQLPFIVLGSVD
GQGDAWAGLLEGQAGFMASPTPTTLDIAARPQADDPVAQGMGEGAALGLLGIELHSRRRN
RMNGVVVAGGKGLRVAVEQSFGNCPRYIQQRDFTFARDPAAPFAATVEQLPALDAAARAV
VEGADTFFVATYADVDGQRQVDVSHRGGNTGFVRIDADGTLTIPDFNGNLFFSTLGNIVL
NGKAGLLFVDFATGDVLQLSGDAEVIFESPEIGAFQGAERLWTFRPRRIVRRPAAMALRW
AMREDGWADSSLLTGNWQQAADQLRAAQYATQWRPMRVARIVEESRSIRSLHLEPVDGAG
VLPHLAGQHLPIRLQVAAGEKPLIRTYTLSVAPSDGIYRISVKREGRVSQFIHDGLREGD
LIDARAPAGAFTLDAQEERPLVLLAGGIGITPMLAMLRHVVYEGWRRQRIRPVTLFYAAR
SKAERAFDRELGDLVAAAQGAVRLVRVLSDTSGAEPGVDYDTAGRIDMALLTRYLAFDDY
AFYLCGPPAFTQGLYDGLRGYNIADGRIHAEGFGPASLVRRPDQPAAAAVTVAPATEAVP
VLFTESLKEGRWTPGSGTLLELAEARGLEPEFSCREGSCGTCKTRLVKGAVSYLKEPSAP
HGDDEVLICCAVPAQPQGASDERLELAL
Download sequence
Identical sequences F6A9B4
gi|333901336|ref|YP_004475209.1| WP_013792242.1.13474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]