SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333902152|ref|YP_004476025.1| from Pseudomonas fulva 12-X

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333902152|ref|YP_004476025.1|
Domain Number 1 Region: 293-429
Classification Level Classification E-value
Superfamily CBS-domain pair 1.34e-21
Family CBS-domain pair 0.0018
Further Details:      
 
Domain Number 2 Region: 441-513
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000109
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333902152|ref|YP_004476025.1|
Sequence length 521
Comment integral membrane protein TerC [Pseudomonas fulva 12-X]
Sequence
MEWIADPTAWLGLLTLIVLEIVLGIDNLVFIAILADKLPPEQRDRARVIGLSLALIMRLG
LLASMAWLVTLTDPLIDVFGKSFSGRDLIMLFGGVFLLFKATMELHERLEGRTHQHGGSR
TYAKFWPVVAQIIVLDAVFSLDAVITAVGMVEHLEVMMIAVIISIGLMIVASKPLTAFVN
ARPTVIMLCLGFLMMIGFSLTAEGLGFHIPKGYLYAAIGFSILIELFNQIARSRRKRSLQ
GQRGLRDRTAHAVMRMLGGKVQADEVGEDIADMLEGEQGETALFDRRERVMISGVLNMAE
LSIQKVMTDRMEVDCINLDDAPEKIQQALLDSPHSRLVVIRNETRDEPLGYVHKKELFKE
LLKGQQPDIESLVRAPINLPDSSSVLSSLEQMRQGSTHVAFVVNEFGGFEGLLTLTDILE
AIAGELPDASEVDGPDVEEVDGGYRVNGAVNLAVLRERMNFAAKPTDDYQTLAGLAMSLL
DRLPLIGDKVEYLGWELTVIEVKERRITRVLLKPDADNSAA
Download sequence
Identical sequences F6AIA5
gi|333902152|ref|YP_004476025.1| WP_013793053.1.13474 WP_013793053.1.25077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]