SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328542736|ref|YP_004302845.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328542736|ref|YP_004302845.1|
Domain Number 1 Region: 6-482
Classification Level Classification E-value
Superfamily ALDH-like 1.19e-149
Family ALDH-like 0.0000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328542736|ref|YP_004302845.1|
Sequence length 485
Comment betaine aldehyde dehydrogenase [Polymorphum gilvum SL003B-26A1]
Sequence
MTHSLILPERRALYYGGAWHDARGGATCECTSPATGESFGPASFGAAEDMAAAIEAAAVA
FPAWRDAPPLERGRRLREIAAVMRAHKDELALIDAADSGNPVAAMLKDIDIATSQLDFFA
GLVTEMKGDTIPMGPNALNLTVREPLGVVGRIVAFNHPLMFCAGKMAAPLAAGNTVVLKP
AEQAPLSVLRFLELIDGILPPGVLNVVHGGPEAGAVLASHPKVAKVGLIGSVPTGRAVMA
GASATVKDVMLELGGKNALIACPDADIEKTARGIVAGMNFAWCGQSCGSTSRAFLHADVH
DAILERVVALCGAFKPGDPTQMDTTMGALISRTQRDKILRYIAKGIEEGARLMCGGKVPD
DPALSNGNFVEPTVFADVTQNMTIAREEIFGPVLSVLRWQDEATMLEEANSVEYGLTCSI
WTRDLATAHRLAARADAGFVWVNKSGAHFLGAPFGGVKQSGIGREECIGELIAFTREKNI
HIALD
Download sequence
Identical sequences F2IZI8
WP_013651862.1.65661 gi|328542736|ref|YP_004302845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]