SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328543672|ref|YP_004303781.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328543672|ref|YP_004303781.1|
Domain Number 1 Region: 292-426
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.05e-53
Family Peptidoglycan hydrolase LytM 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|328543672|ref|YP_004303781.1|
Domain Number - Region: 89-197
Classification Level Classification E-value
Superfamily ALDH-like 0.00883
Family ALDH-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328543672|ref|YP_004303781.1|
Sequence length 439
Comment transmembrane peptidase [Polymorphum gilvum SL003B-26A1]
Sequence
MSDNTSSPRKSFGKRGGFHHVTITRGNTSRTFVIRPWIMGTAAVVLILFLGGYLSAAAYL
FLRDDLLGARAAQQAEIESAYQARIAHLRAEIDRLTSRQIVDRASVETLVESLIARQDAL
SDRHSKVASLVERAARSGLRVAIDNPVPPSKPVFAQGTLQNPAAGDASAIGGEPAPIANP
LPALGLRGTSSVVPLDHAPSAATTVDEGKLSQVEDTLKRMYSESAAALDALAVAAEQHID
TIVEATAPLGIRLPALSDASVGANVGGPYIPLPAFTFDERIQRAERALAALESLKTAARR
LPLTRPIANVEVSSDYGPRLDPFLRTLAMHTGIDFKANYGTAVRAAAGGTVIAADRQGGY
GKMVEIRHAGDVVTRYAHLSQIKVGEGDVVEPGDIVGLVGSTGRSTGPHLHYEIRLDGEA
VDPFDFVVAGDHLAPILAN
Download sequence
Identical sequences F2IXG1
WP_013652797.1.65661 gi|328543672|ref|YP_004303781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]