SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328544417|ref|YP_004304526.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328544417|ref|YP_004304526.1|
Domain Number 1 Region: 10-480
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-165
Family ALDH-like 0.0000000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328544417|ref|YP_004304526.1|
Sequence length 485
Comment Succinate-semialdehyde dehydrogenase subfamily protein [Polymorphum gilvum SL003B-26A1]
Sequence
MRLDAKLMKQAVHIAGSWTGADSGATIEVNNPATGEVIGTVPRCGRTETARAIDAAAAAF
KDWKAKTAEERATLMHRLADEIMAELDGLAELLTTEMGKPLAEAKGEITLSAKYIRFLAE
EGKRIYGDIIPSPWAGKKILVTKEPVGVVGAITPWNFPNSMIARKLGAALAAGCTMVIKP
ASQTPYSGLVYGVLAERAGIPAGVINVVTGSAGEIADEMCENPLLRKITFTGSTEVGKKL
ASNATRHMKKISMELGGNAPFIVFDDADLDAAVAGAIASKFRNSGQTCVCANRLYVQAGV
YDAFAEKLKAAIEAQLKVGDGRAAGTTQGPLIDEKAIAKVEEHIADALAKGGRVLTGGER
AGNVGSFFKPTLVADATAAMKVAREETFGPLAPLFRFETEEEAVAAANATEYGLACYFYS
QNLGRVFRVMERLEYGLVGVNEGIITTEVAPFGGVKDSGMGNEGSKYGLDDYLNIKYACV
GGLGM
Download sequence
Identical sequences F2J5W8
gi|328544417|ref|YP_004304526.1| WP_013653536.1.65661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]