SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328545562|ref|YP_004305671.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328545562|ref|YP_004305671.1|
Domain Number 1 Region: 9-484
Classification Level Classification E-value
Superfamily ALDH-like 1.07e-155
Family ALDH-like 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328545562|ref|YP_004305671.1|
Sequence length 491
Comment aldehyde dehydrogenase [Polymorphum gilvum SL003B-26A1]
Sequence
MLDKVSSAPTIRGIYIGGQWVPAARTFEDLNPSDNTVYARIPDGSAADMRRAIEAAQAAF
PEWSGRAFHDRAHLLLKIADVWQKRAADFCAAAVAEGGGWKGKGLFEAGYVAEVFRSAAA
LCYQSIGEVLPSEHHKLMMATRFPLGVVGVISPWNMPGILTSRGFAAALAVGNTVVLKPS
EDTPYSGGLYFAEILEEAGVPAGVFNVVTCSRDSVGAVGDEMIGNPKVKAISFTGSTAVG
RHIAAKCGAYLKKVCVELGGKDSMIVLDDADLDAAARAANFGSFMHQGQVCMSTEKLLVH
EKVYAPFMDRFLARARKLKTGHTDDPSNVIGPLVNNRQAQRVKALIDDAVAKGATVELGG
RAWDNFVEPTVLTNVDSSMNIWHDETFGPVVIVSPFRDEDEAVALNNDTEYGLTAAVWSR
DEARALRMAQRLETGIAHVNCQNINDEPHVPFGGTKASGVGRYGGRWSLDAFTELRWITL
DRGGRHFPPQF
Download sequence
Identical sequences F2J5J6
WP_013654675.1.65661 gi|328545562|ref|YP_004305671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]