SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328545568|ref|YP_004305677.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328545568|ref|YP_004305677.1|
Domain Number 1 Region: 4-473
Classification Level Classification E-value
Superfamily ALDH-like 1.17e-130
Family ALDH-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328545568|ref|YP_004305677.1|
Sequence length 484
Comment dehydrogenase PhnF [Polymorphum gilvum SL003B-26A1]
Sequence
MFVAHGIIAGAAVAAPDQRLYERRDIVTGDIVTQAAALGTSEASAAADAAAGAFPAWSAL
DPERRASLLLRGAAILHERLPQLCAIGEREVGAAADWIAFNVRIAQDTLSQAASLAGAVG
ETAAAGAPPGLDYRIVRRPAGVVLGLAPWNAPVTLAVRAVAAPLALGNTVVLKGSELCPK
IHETVTRALIDAGLPDGVLNFVSNAPEDSRDVVEALIAHPAVRRVNFTGSTRVGREIAVL
AARHLKRCLLELSGKASSIILADADLEATARTIAHGAFFNQGQVCMSTDRIVVEDAVAGR
FVPLLKEQAERLRADPATGRSPLGQVIGPEAVLRLHGLVEDAVAKGAVLITGGESSGTLM
QPTVLDHVAYGMRIYEEEIFGPAVGVIRVADAEEAVTVANDTEYGLTAAVFSRDLDRARA
IARRLEVGAVHINGSTVCDDPAMPYGGVKASGYGRFGGRAVIEEFTEIQWMTERAEPASD
PAGG
Download sequence
Identical sequences F2J5K2
gi|328545568|ref|YP_004305677.1| WP_013654681.1.65661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]