SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328544289|ref|YP_004304398.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328544289|ref|YP_004304398.1|
Domain Number 1 Region: 28-243
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.47e-32
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|328544289|ref|YP_004304398.1|
Domain Number - Region: 232-290
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0687
Family GlnE-like domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328544289|ref|YP_004304398.1|
Sequence length 300
Comment MetF-like protein [Polymorphum gilvum SL003B-26A1]
Sequence
MTEIRSRTIDEVQSACAPLRGPLWLAPWSLEATAPTAADIAALAPLVPPGTDVLLSALPR
IPHDEQIAAARLVRAAGLEPVLHLSARKFASEAELGHLLETACRDIGLRKVLVIAGDIDA
ARGPFASSLDLIESAPFRAAPLQSVGIGGYPEGHPFVADADLERSLRSRLDAIRDAGRAP
FLVSQFCFDAERILRWLDGLRRLEPALPVRIGLAGPASAATLMKVALRCWVDLPMRHART
ATRLLSSGTPDPIVAGLDAGLRPHHRSGPLQIHVYGFGGLVKAAAWAGEAARTARAGWTA
Download sequence
Identical sequences F2J4F2
gi|328544289|ref|YP_004304398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]