SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328545317|ref|YP_004305426.1| from Polymorphum gilvum SL003B-26A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328545317|ref|YP_004305426.1|
Domain Number 1 Region: 562-1025
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-125
Family ALDH-like 0.000000523
Further Details:      
 
Domain Number 2 Region: 179-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.28e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000655
Further Details:      
 
Domain Number 3 Region: 14-178
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.18e-47
Family N-terminal domain of bifunctional PutA protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328545317|ref|YP_004305426.1|
Sequence length 1042
Comment proline dehydrogenase [Polymorphum gilvum SL003B-26A1]
Sequence
MSASAPNPEIAAVPPFRAAYAPDDEGLVRQLLAETGLPADAEARIDARAAGYIQDMRSAR
SGLGGVEDFMREFGLTTREGLAMMVLAEALLRVPDAATADRLIEDKLAAARFDQAAGHKS
DTWLVSASSWALGVTARLLHPGDTPDTILAALVKRLGMPAVRTATRQAMRLLGHQFVLGE
TIGQALERASGQEAKGYRYSYDMLGEGARTAADAQRYFQAYAAAIEAIGTAAGNRPLPAR
PGISVKLSALHPRYEAVKADRVQAELLPRLLELVRMARRYDLNFTIDAEEADRLEISLDL
VAAVVADPVTAGWDGFGLAVQAYQKRGVEVVDWLVELARAGNRCLMVRLVKGAYWDTEIK
RAQERGLADYPVFSRKAATDLSYLACARRLLAARDILYPQFATHNALTVAQIQELAGPDG
GYEFQRLHGMGESLYRAVAERHGYPCRIYAPVGGHKDLLAYLVRRLLENGANSSFVSVVG
DAAVPVDRLLLRPADILDGGGRVRNAAIPLPSDLYGDSRRNSAGVELGHAEERARLVDGM
TAAVLSVAAATVLAPGLAPVGRPKPVHSPADGRTLVGEVVEADPEDAARAVGSAACGFEV
WSRCPVESRAAALERAADLIEANRDRLMALLALEAGKTLPDGIAEIREAVDFCRYYAAEA
RMRFGEGCLMPGPTGEENRYRLRGRGVFVCISPWNFPLAIFVGQVAAALVAGNAVVAKPA
EQTPLIAREAVTLLHRAGVPEDALLFMPGDGRVGAALTADPRIAGVAFTGSTETAWAINA
SLAAKRGPIVPLIAETGGINAMLVDATALPEQVCDDVVTSAFRSAGQRCSALRLLYLQDD
IADGLLEMIEGAAAELTLGDPRDQATDIGPVIDADARDGILAHIEAMAAADRLRFAGTVP
GGDLAGGFWVAPHIVTLDRPSDLTREVFGPVLHVVRYRAKELDAMLEAIAATGYGLTLGV
HSRIDATVKQVVDRLSVGNVYVNRNTIGAVVGTQPFGGSGLSGTGPKAGGPAYLQRFALE
QVVSINTAASGGNASLLAHSEE
Download sequence
Identical sequences F2J2U8
WP_013654431.1.65661 gi|328545317|ref|YP_004305426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]