SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479130509|ref|YP_005070469.1| from Arthrospira platensis NIES-39

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479130509|ref|YP_005070469.1|
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily RbcX-like 1.2e-44
Family RbcX-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479130509|ref|YP_005070469.1|
Sequence length 121
Comment possible Rubisco chaperonin [Arthrospira platensis NIES-39]
Sequence
MDIKKVAKDTTKVLTSYLTYQAVIIITNQLTETNPGLAIWLSDFSSRGKIQDGEAYLEEL
LQENQELAFRVMTVRDHLTQEVADYLPEMVRLGIQQGNMAHRRQYLERMTQLTTSETNPP
D
Download sequence
Identical sequences D4ZVW6
gi|479130509|ref|YP_005070469.1| WP_014276230.1.32502 WP_014276230.1.3704 WP_014276230.1.77122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]