SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|264679384|ref|YP_003279291.1| from Comamonas testosteroni CNB-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|264679384|ref|YP_003279291.1|
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 7.06e-59
Family PA2201 N-terminal domain-like 0.0000755
Further Details:      
 
Domain Number 2 Region: 137-209
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 0.000000000000126
Family PA2201 C-terminal domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|264679384|ref|YP_003279291.1|
Sequence length 210
Comment hypothetical protein CtCNB1_3249 [Comamonas testosteroni CNB-2]
Sequence
MSQTFQHHGQLAAACAEWAKISLTGLQPRRNLNLSDKKADWKEALSALKRFANSDSYKAH
QNFQAHAALENYWKWKEVGEQARWLLIYGIDLGLCGDVLRPIYQEVVALWIDAASVAEHA
RASMAQETGEDYGVGAPINTRADDYAVAVTLLSLATLLDAQDDVPAIDEHVLAFDTDQLL
DYLCAGGLQLQQVSEELFHKRPYGAMKPFF
Download sequence
Identical sequences D0J2M2
688245.CtCNB1_3249 gi|264679384|ref|YP_003279291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]