SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327400747|ref|YP_004341586.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327400747|ref|YP_004341586.1|
Domain Number 1 Region: 185-349
Classification Level Classification E-value
Superfamily RibA-like 7.98e-58
Family RibA-like 0.00000746
Further Details:      
 
Domain Number 2 Region: 2-187
Classification Level Classification E-value
Superfamily YrdC/RibB 2.17e-31
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327400747|ref|YP_004341586.1|
Sequence length 380
Comment GTP cyclohydrolase-2 [Archaeoglobus veneficus SNP6]
Sequence
MQEIIEAVRAGKPFIIFDDKKSVLGVPADVVSGRVIALIMKNCDEYRLAMPWKHITALGL
NRFLLYGGTVIPLDCSKNGISAEERADFIRRLVKGNVKPEEIVFPGRIFVEEAKEGGVLE
RPAFGEACIDIARMAGFSSSALYSTLITPSGDVADESYAAEFAKENGLPVISIKELIMHR
LKNEKLVKRVVEATLPTKFYGTFKAVGYETPIGEIVALVRGDVSEGDVLVRIHSECLTGD
VFHSLRCDCGDQLEKALKMIDKEDKGVAIYMRGHEGRGIGLINKLMAYKLQEEGKDTVEA
NIELGFPPDMRSYGIAAQILIDLGVKSVRLMTNNPLKIEELKKYGFKVRREAIEVEPSEE
NLNYLKAKKEKMGHMLCIND
Download sequence
Identical sequences F2KS30
WP_013683543.1.73781 gi|327400747|ref|YP_004341586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]