SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327400808|ref|YP_004341647.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327400808|ref|YP_004341647.1|
Domain Number 1 Region: 14-194
Classification Level Classification E-value
Superfamily SIS domain 5.31e-39
Family mono-SIS domain 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327400808|ref|YP_004341647.1|
Sequence length 196
Comment 6-phospho 3-hexuloisomerase [Archaeoglobus veneficus SNP6]
Sequence
MAEARGRLMGEMLIRFLDTLGEQINSLKRELDPSQVEELIKAIEGANKIFVMGAGRSGFV
AKAFAMRLMHLGYNVYVVGETVTPRIGRDDVLISISGSGETTSVVNISRKAKELIGSKLV
AITQNKDSTLARMSDVVVLLRAKDKTQKDENLSSIAPLGTMFELTALIFLDGLVAELMSL
KSLTERDLEQRHAVLE
Download sequence
Identical sequences F2KSG3
gi|327400808|ref|YP_004341647.1| WP_013683597.1.73781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]