SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327401489|ref|YP_004342328.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327401489|ref|YP_004342328.1|
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000247
Family Thioltransferase 0.046
Further Details:      
 
Weak hits

Sequence:  gi|327401489|ref|YP_004342328.1|
Domain Number - Region: 147-176
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00328
Family Cytochrome c3-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327401489|ref|YP_004342328.1|
Sequence length 196
Comment hypothetical protein Arcve_1613 [Archaeoglobus veneficus SNP6]
Sequence
MRRLLPVLGTILIFSSLIIGCTQNQVEMKTETGAKITETENLNENETVKVFFYYSPRCPS
CVKIKPYMNLLREEVQGIKFDFCDVSNKSLCSNESLWVAKHIGLFGVPTAVFIQGDRVAV
FVGWKKVAKLGVYLEELGFEVPEVVYGNTSYDVQECIDCHEGRGINPPSTYSCTYCCHMA
QIQQAQNQTQNVTQGS
Download sequence
Identical sequences F2KQ10
gi|327401489|ref|YP_004342328.1| WP_013684269.1.73781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]