SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327401490|ref|YP_004342329.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327401490|ref|YP_004342329.1|
Domain Number 1 Region: 211-334
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000993
Family mono-SIS domain 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|327401490|ref|YP_004342329.1|
Domain Number - Region: 18-139
Classification Level Classification E-value
Superfamily SIS domain 0.00254
Family mono-SIS domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327401490|ref|YP_004342329.1|
Sequence length 370
Comment sugar isomerase [Archaeoglobus veneficus SNP6]
Sequence
MYMMCRNVPYLERVYRNVDAIRKREFKTFYDHLYSADCIIPVGEGRSQCALYIGLGRINK
DVKMPDSIDFPGKNMFEAAKVLEKKYKRISLLVNSGSGETTTPKRIVRELSAYIEQTDSK
KFTIDAIVSNPDSAIGRVGEKEYGAIIELRGRGREPKTAEEYMKHGIMNDIYELGSLMLI
HRIKQAVNSGKSYRDVFRGIQNEFRRISKFVDDFVDSDIYDNLVEAMERRSHVIVGGLGM
AKIVALMTVIRLQHVKRSIGDEVYLSGPLAPRPRAGDVLLLISWSGETEPLLSWCKEAKD
FGAEVYSIVGRESTLSEKTNSFVMDCEVENFYCYAAFVLSPLPLSVVERLASRGLRLPEY
IIGWYHSVTQ
Download sequence
Identical sequences F2KQ11
gi|327401490|ref|YP_004342329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]