SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327400297|ref|YP_004341136.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327400297|ref|YP_004341136.1|
Domain Number 1 Region: 33-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-58
Family Extended AAA-ATPase domain 0.00038
Further Details:      
 
Domain Number 2 Region: 306-412
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.31e-27
Family Helicase DNA-binding domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327400297|ref|YP_004341136.1|
Sequence length 430
Comment cell division control protein 6-like protein [Archaeoglobus veneficus SNP6]
Sequence
MVKLLKGGEGTHHVLGWLIMRNIFESLITSPKIFRNRDVLRHSYTPDYLPHRKEQIESLA
SILVPALKGETPSNVFIYGKTGTGKTATVKFVGNQLEAMGRKLNVHCYVHYLNCELIDTQ
YRVLATLAKVLGRNVPMTGWPTDQVYEEVRRAIDSRDQTIVIVLDEIDKLVKKGDEVLYN
LSRINGELERARVSIIGISNDLKFKNFLDPRVLSSLSEEELIFPPYNAEQLQDILEQRAE
LAFYEGVLDDDVIPYCAALAAQEHGDARKALDLLRVSGEIAEKENADRITRDHVKKAVKK
IETDHVVEAVRTLPTQSKVLLFGMIILTESGMRKFTTGEVYAVYRSLCRKLNIDCLTQRR
VSDLIAELDMLGIINSIVISKGRYGRTREIKLDVPIEPIKQTLLEDYRLEALSVVERSMR
SVTSLEAFEV
Download sequence
Identical sequences F2KPJ0
gi|327400297|ref|YP_004341136.1| WP_013683095.1.73781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]