SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334140682|ref|YP_004533884.1| from Novosphingobium sp. PP1Y

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334140682|ref|YP_004533884.1|
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily NTF2-like 5.24e-31
Family BaiE/LinA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334140682|ref|YP_004533884.1|
Sequence length 166
Comment hypothetical protein [Novosphingobium sp. PP1Y]
Sequence
MTLLLPLEDRLALQDLIADYSWALDTGDVDALVACFTPDARMVEEVFEDPDIWEGHEGIR
GIAEHYRNAPGFPGRQHHVTQIQFRPQDDGSVKMRAFAFVTECDGEPPYVLRFTGWYDDH
AVKCEDERWRFHRRTVRLWDGEILKNFPGKGEWVPRKRPESLVIDR
Download sequence
Identical sequences F6IKW4
gi|334140682|ref|YP_004533884.1| WP_013832459.1.5499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]