SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332304637|ref|YP_004432488.1| from Glaciecola sp. 4H-3-7+YE-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332304637|ref|YP_004432488.1|
Domain Number 1 Region: 147-342
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-57
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000512
Further Details:      
 
Domain Number 2 Region: 428-559
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000195
Further Details:      
 
Domain Number 3 Region: 10-143
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.00031
Further Details:      
 
Domain Number 4 Region: 344-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.21e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332304637|ref|YP_004432488.1|
Sequence length 569
Comment sulfite reductase (NADPH) hemoprotein subunit beta [Glaciecola sp. 4H-3-7+YE-5]
Sequence
MTTDNKFVVQGKLADNERLKGESNFLRGTIAEDLKDDLTGAFVGDNFQLIRFHGMYQQDD
RDLRAERAKQKLEPLQNVMLRARLPGGIIKPEQWLAIDQFAEEKSLYGSIRLTTRQTFQF
HGVLKPNIKLMHQTLNQVGIDSIATAGDVNRNVLCTSNPIESAVHQEAYEWATKISEHLL
PKTRAYAEIWLDGEKKETTDHEPILGSHYLPRKFKTTVAIPPLNDVDVHANDLNFIAISK
DGKLIGFNVLVGGGLAMTHGDHTTFPRKASDFGFINVEDTLAVAEAVVTTQRDWGNRVNR
KNAKTKYTLERVGVDNFKAEVEKRSGITFGESQAYEFTERGDRIGWVEGIDGKHHLTLFI
ENGRILDYPGKPLKTGCAEIAKIHEGDFRLTANQNLIVAGVSEQNKAKIEEIARAHGLIE
DELSAQRKDSMACVALPTCPLAMAEAERYLPEAVTQLEGLLAKHEIAQKSIIYRVTGCPN
GCGRAMLAEIGLVGKGPGKYNLHLGGNREGTRIPKMYKENIGEQQIMDELDVLIGQWAKD
GQSDESFGDFVVRTGVIAEVVNSAEDFYA
Download sequence
Identical sequences F4AHT3
gi|332304637|ref|YP_004432488.1| WP_007986972.1.56369 WP_007986972.1.80374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]