SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332306278|ref|YP_004434129.1| from Glaciecola sp. 4H-3-7+YE-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332306278|ref|YP_004434129.1|
Domain Number 1 Region: 637-811
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.23e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 4-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.66e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0043
Further Details:      
 
Domain Number 3 Region: 506-645
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.91e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 149-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.73e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332306278|ref|YP_004434129.1|
Sequence length 861
Comment nitrite reductase (NAD(P)H) large subunit [Glaciecola sp. 4H-3-7+YE-5]
Sequence
MSANTISIVVVGNGMVGHHFVEQITNHDKTDSSVNYKVTVLSAEPRLAYDRVHLSEYFSG
KTADDLALTTPEQYQALGVDFHLDAAVVDIDKQAKVVKTQSGQSFTYDKLIMATGSYPFV
PPIEGNDQPHCLVYRTIEDLEDISASAKVSKTGVVVGGGLLGLEAANALREAGLETHVVE
FAPQLMAVQVDTGGGRLLKDKIESLGVQVHTQKATQRIEAGQTSRYRMCFADGEFLETDM
ILFSAGIRPQDTLARQYELNIGERGGIVVDNHCVTSDPDIYAIGECALWNNCIFGLVAPG
YTMARAAASHITGGDVEFLGADMSTKLKLMGVEVGSIGDAHARIPGAQTYIYENQPDGVY
KKIVVNREQSVLLGAVLVGDTSDYDTLLQYALNGIDLPENPESLILPVTGDAPSGGLGAD
ALPDTATICSCHNVSKGDIIAAFDGGACDLSGVKSCTKASTGCGGCSALLKTVVDSELGK
RGVEVKKDICEHFAYSRQELYHMVKVGKIKTFDDLIAKHGHGLGCEICKPAVGSIMASVW
NDFVLEKPHVALQDTNDTYLGNMQKNGTYSVVPRIAGGEITPDKLIVLGQVAKKYNLYTK
VTGGQRIDLFGARVEQLPPIWEALIAAGFETGHAYAKSLRTVKSCVGSTWCRYGVQDSVG
QAIDLENRYKGLRAPHKIKFGVSGCTRECAEAQSKDIGVIATENGWNLYVCGNGGMKPRH
ADLFATDLDDATLVKYIDRVLMFYVATADRLQRTSVWLENLEGGLAYLQDVVINDSLGLG
DELEQQMQHITDTYQCEWKTAIEDESSRKRFRQFVNSDESDKNVVFVQERAQIRPATEAE
LDTLVKSGKGTEQIIDIVELA
Download sequence
Identical sequences F4ANS1
WP_013753620.1.56369 gi|332306278|ref|YP_004434129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]