SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332306415|ref|YP_004434266.1| from Glaciecola sp. 4H-3-7+YE-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332306415|ref|YP_004434266.1|
Domain Number 1 Region: 54-190
Classification Level Classification E-value
Superfamily CBS-domain pair 1.23e-34
Family CBS-domain pair 0.0019
Further Details:      
 
Domain Number 2 Region: 203-284
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-20
Family CorC/HlyC domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332306415|ref|YP_004434266.1|
Sequence length 286
Comment CBS domain-containing protein [Glaciecola sp. 4H-3-7+YE-5]
Sequence
MSEDNPPSTNGSANKGWLDKIVQSFTGEPKSKDELFSVITDAEQREVINQETREMIEGVM
EVSEMRVREIMIPRAQMTTIDITETVDKFLPIMLDSAHSRFPVISEDKDHIEGIILAKDL
LKYAFLPGKEFELKQVLRPAVIVPESKRVDVLLKEFQQKRFHMAIVVDEYGGVSGLVTIE
DILELIVGEIEDEHDAEDTNTDNIRALNKHTYSVKALTELEDFNEFFGTEFDEEEADTIG
GIVLKAFGHMPMRDEKVSINGFVFAVTNSDARRLIQLKVTLPHTED
Download sequence
Identical sequences A0A2E7GKS0 F4AQ67 K6XH15
gi|332306415|ref|YP_004434266.1| WP_007988085.1.17900 WP_007988085.1.56369 WP_007988085.1.80374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]