SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332307637|ref|YP_004435488.1| from Glaciecola sp. 4H-3-7+YE-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332307637|ref|YP_004435488.1|
Domain Number 1 Region: 342-445
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.24e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 435-601
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-25
Family Flavohemoglobin, C-terminal domain 0.006
Further Details:      
 
Domain Number 3 Region: 595-706
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.6e-19
Family 2Fe-2S ferredoxin-related 0.014
Further Details:      
 
Domain Number 4 Region: 172-284,313-349
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000617
Family PNP-oxidase like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332307637|ref|YP_004435488.1|
Sequence length 711
Comment Oxidoreductase FAD-binding domain-containing protein [Glaciecola sp. 4H-3-7+YE-5]
Sequence
MNTHITSSAFHEGEQQMQRSAGSYEKMRTIGRRAIREFMPDQHRQFFQQLPFMVLGSTSD
KGQLWASILPGKPGFVQSPSPTQLTVNSPILSGDPLAAAITQGARLGLLGLEMSTRRRNR
VNACVTSAANNQFALEVEQSFGNCPQYIQTRDLHFIRSPEAPYKAPRAEAFFELGDAVKT
FIRQADTFFVASSAGHEPSNEVNRQVSAHNAMGVDVSHRGGMPGFIKVDENTLTIPDYAG
NNFFNTLGNFVLNPKAGLLFVDFTSGDVFMLTGTVTLLASDSPLIEGFQGAQRGWQFTLT
QGVTLKAALPFRAQFDSYSPNSQATSTWSQTEAVLKAQAKRNQWRAFTVSKIEDESSTIR
SFYLQPKDDAPVLPFSPGQHLTLRIKQQNSDSWIVRNYTVSSAPTQSGYRISVKREEYGA
ISNTLHSRISIGSEIQIKAPSGHFFIDNTQQRPAILIGAGVGITPMVAMANDAVNEGIRT
RYIRPMAVIQAAKNSEQRAFYAELSNTSKRSAGRIQYYSVLSQAHNTQTQNAIASSDYTS
QGRISQSLVMDVLNAMATEHSDDFPSLFDKDFYLCGPQGFMQSMYDLLIGIGVKDEDIHA
EAFGPSSLLRHSTDSSNHAALEAESAVIKFAHSGIEQSWYKGDKPLLDVAESKGLTPPYS
CRNGQCGSCAVKLKSGAVTYRTKPSAHIDASEVLLCCAVPAKDSQTITLAL
Download sequence
Identical sequences F4AQZ9
WP_013754460.1.56369 gi|332307637|ref|YP_004435488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]