SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|365965865|ref|YP_004947430.1| from Propionibacterium acnes TypeIA2 P.acn17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365965865|ref|YP_004947430.1|
Domain Number 1 Region: 299-575
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.5e-42
Family Esterase 0.0089
Further Details:      
 
Domain Number 2 Region: 613-685
Classification Level Classification E-value
Superfamily PKD domain 0.0000000017
Family PKD domain 0.0052
Further Details:      
 
Domain Number 3 Region: 152-284
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000275
Family Complement components 0.032
Further Details:      
 
Domain Number 4 Region: 678-720
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000497
Family TSP type-3 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|365965865|ref|YP_004947430.1|
Sequence length 728
Comment hypothetical protein TIA2EST22_09710 [Propionibacterium acnes TypeIA2 P.acn17]
Sequence
MPVPALAAGGPKPADYAAQAGKAADYINGHSADLTKGDLGPELDGALALISAGKTDAKLF
GMIKKDIKAKGPSYCTSKNVGGCAKVTITLLAAGEPTTYGGTDYAKPVTSLPDSALKERP
FHQALDMIALERLGKPIPQKLFKSITDYVSARPGRNYPSTDGLMLAALSHVVSTAYGQEG
ITAVKAALVKRLDADRQTDGWGWPDHGANVRATTRVAPGLYRAGDANHKDQAVKGQAWLA
GQQQVDGSFPSNVVSPAWTMMATVQAVPVLRGLQSLDTIGANPARAVTVDGWVPPRRLVK
MTVLGDSYSAGNGTLVDGYPADGSYRSPKNYGSVLTRRLNREFGDDTTFQTDVRAWSGAQ
ITTGDHTIVSQADGMDPHTHVVLMTAGGNDLDFTSVVENCFIERVWSAAECGGSVDASRK
KIDATMTKTTTLLSHIQNRLADPAHTRVILIGYPYLIPADEDIPSTDVPSTRVRAAEDEF
RTRQAATIKAWNTSHALKVTYTPTTSLFNTHEPEPLVHNGDQNPQRWINAVFETAGYSYN
GNGVILSEPSQDEKNWYHPNVVGHEKIAGLVHDALLSRTVRSASLSESVAQVASVPGVRM
RAAVIGQSQVRRGNPLSLDASSSYTAFGHIRRWQWDLDGDRHYEIDTTTPEITRTLTRIG
TYQAHLRITDTTGTTDTLTFPIQVTRDGDGVPDAQDNCPTIANQDQTDTDHNGIGDACDP
HTTTKTPR
Download sequence
Identical sequences WP_014167324.1.98061 gi|365965865|ref|YP_004947430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]