SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336053901|ref|YP_004562188.1| from Lactobacillus kefiranofaciens ZW3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336053901|ref|YP_004562188.1|
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Formyltransferase 6.15e-63
Family Formyltransferase 0.00000401
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 5.65e-24
Family Post formyltransferase domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336053901|ref|YP_004562188.1|
Sequence length 314
Comment methionyl-tRNA formyltransferase [Lactobacillus kefiranofaciens ZW3]
Sequence
MTSIIFMGTPEFSVPVLEGLINHGYEIKAVVTQPDKKVGRKQKITKSPAKIAAEKHDLPV
FQPIKLSGSEEMKQLIDMHADLIVTAAYGQFLPTKFLNSVKIAAVNVHGSLLPKYRGGAP
IQYSLINGDQETGITIMEMVKKMDAGDIYAQEALKIEPEDNAGTLFEKLSYLGRDLLLKT
LPSIIDGSIKKTPQDPEQVVFSPNITKEQEKITVKMTAREANNMIRALNPDPGAYMMIEG
KRFKVWQAEVAQETTELNPGCLIANKGRFAIAFANKSVLNLLVVQPSDKKRMEIKSFLNG
QGSKFKPGEEIVDQ
Download sequence
Identical sequences A0A0R1PJE7 A0A1G5UVR2
gi|336053901|ref|YP_004562188.1| WP_013853884.1.100755 WP_013853884.1.12610 WP_013853884.1.22002 WP_013853884.1.49565 WP_013853884.1.51352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]