SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336054272|ref|YP_004562559.1| from Lactobacillus kefiranofaciens ZW3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336054272|ref|YP_004562559.1|
Domain Number 1 Region: 41-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.01e-72
Family Phosphate binding protein-like 0.00000364
Further Details:      
 
Weak hits

Sequence:  gi|336054272|ref|YP_004562559.1|
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily Ammonium transporter 0.00353
Family Ammonium transporter 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336054272|ref|YP_004562559.1|
Sequence length 286
Comment outer membrane lipoprotein [Lactobacillus kefiranofaciens ZW3]
Sequence
MRKRRRRNTIILSIIGILILIAGWFSFGPGLNINNQAQNKTVVVGVVSQSKQDAAIWKSV
AKTAKEDYGITIKIKNFTDYNQPNKALKSGDVDLNAFQHYAFLKAWNKSNGGGVVPIGRT
YIAPIRLYSKKYKKLADLPDGATIAIPNDATNESRALFVLKNAGLINLRKGKALVTVADI
TKNPHNFKLKEVGAEQTGRVINSVDASVVNNDYAGPAGLGDKQTIYIEPVNKDSKQWINI
ICAKKGQANNKLYQDVVKAYQTKKTKQLTKHFYGNSQIAAWDIKIK
Download sequence
Identical sequences A0A1G5VTZ8
WP_013854250.1.12610 WP_013854250.1.22002 WP_013854250.1.49565 WP_013854250.1.51352 gi|336054272|ref|YP_004562559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]