SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47525352|ref|YP_016701.1| from Bacillus anthracis str. 'Ames Ancestor'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47525352|ref|YP_016701.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.62e-85
Family Ribosomal protein L1 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|47525352|ref|YP_016701.1|
Sequence length 230
Comment 50S ribosomal protein L1 [Bacillus anthracis str. 'Ames Ancestor']
Sequence
MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAAFRLGVDPKKADQQIR
GAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKIQQGWFDFDVVVATPDM
MGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKVSF
EDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGVRVDVSTLA
Download sequence
Identical sequences A0A0B5NST9 A0A0B5SYY0 A0A0B5ZQG4 A0A0E1MBY1 A0A0F5RJK8 A0A0K6MSB4 A0A0T8P4C1 A0A154AXU7 A0A1J9UCL2 A0A1J9UXM1 A0A1J9YLA4 A0A1J9Z0F2 A0A1K0ADK2 A0A1S9BCK4 A0A229M3I9 A0A242WEM5 A0A242Y120 A0A242ZG32 A0A243BLU6 A0A243CYQ9 A0A243IAX0 A0A243IPB8 A0A243NAT0 A0A246UJQ6 A0A2A7ECN9 A0A2A8UYD5 A0A2B4FAP3 A0A2B4LFL9 A0A2B8UTG0 A0A2K1RYZ2 A0R8G8 B7HQT2 B7JKA6 B9IZI2 C1ET27 C2QM22 C3BWC0 C3LJ70 C3P9P3 D8GWP5 F0PR13 J8GC09 J8J037 Q63HA2 Q6HPS0 Q73FA8 Q81VU2
gi|225862150|ref|YP_002747528.1| gi|217957673|ref|YP_002336217.1| gi|49183132|ref|YP_026384.1| gi|42779179|ref|NP_976426.1| gi|229602767|ref|YP_002864749.1| NP_842666.1.87267 WP_002020168.1.100059 WP_002020168.1.100214 WP_002020168.1.100241 WP_002020168.1.100409 WP_002020168.1.100595 WP_002020168.1.100684 WP_002020168.1.10069 WP_002020168.1.100873 WP_002020168.1.101309 WP_002020168.1.101550 WP_002020168.1.101843 WP_002020168.1.101931 WP_002020168.1.10208 WP_002020168.1.10762 WP_002020168.1.11044 WP_002020168.1.11060 WP_002020168.1.11387 WP_002020168.1.11427 WP_002020168.1.1228 WP_002020168.1.12289 WP_002020168.1.12751 WP_002020168.1.13024 WP_002020168.1.13115 WP_002020168.1.13221 WP_002020168.1.13233 WP_002020168.1.13299 WP_002020168.1.13820 WP_002020168.1.14721 WP_002020168.1.14882 WP_002020168.1.15163 WP_002020168.1.15502 WP_002020168.1.15569 WP_002020168.1.16013 WP_002020168.1.16156 WP_002020168.1.16170 WP_002020168.1.16199 WP_002020168.1.16997 WP_002020168.1.17146 WP_002020168.1.17408 WP_002020168.1.17424 WP_002020168.1.17899 WP_002020168.1.17927 WP_002020168.1.1850 WP_002020168.1.18840 WP_002020168.1.18976 WP_002020168.1.19173 WP_002020168.1.19258 WP_002020168.1.19435 WP_002020168.1.19445 WP_002020168.1.195 WP_002020168.1.20390 WP_002020168.1.20665 WP_002020168.1.20680 WP_002020168.1.20687 WP_002020168.1.20865 WP_002020168.1.20973 WP_002020168.1.21021 WP_002020168.1.21172 WP_002020168.1.21258 WP_002020168.1.21643 WP_002020168.1.21776 WP_002020168.1.226 WP_002020168.1.22865 WP_002020168.1.22991 WP_002020168.1.23100 WP_002020168.1.23110 WP_002020168.1.23200 WP_002020168.1.23615 WP_002020168.1.23873 WP_002020168.1.24184 WP_002020168.1.2419 WP_002020168.1.24334 WP_002020168.1.24377 WP_002020168.1.24556 WP_002020168.1.24608 WP_002020168.1.24676 WP_002020168.1.24709 WP_002020168.1.24759 WP_002020168.1.2521 WP_002020168.1.25316 WP_002020168.1.2569 WP_002020168.1.25716 WP_002020168.1.25752 WP_002020168.1.25757 WP_002020168.1.26000 WP_002020168.1.26499 WP_002020168.1.26665 WP_002020168.1.26721 WP_002020168.1.27334 WP_002020168.1.27644 WP_002020168.1.27987 WP_002020168.1.28729 WP_002020168.1.28913 WP_002020168.1.29101 WP_002020168.1.29209 WP_002020168.1.29451 WP_002020168.1.29787 WP_002020168.1.29804 WP_002020168.1.30110 WP_002020168.1.30216 WP_002020168.1.3026 WP_002020168.1.30317 WP_002020168.1.30336 WP_002020168.1.31490 WP_002020168.1.31503 WP_002020168.1.31685 WP_002020168.1.3236 WP_002020168.1.32522 WP_002020168.1.32576 WP_002020168.1.33045 WP_002020168.1.33061 WP_002020168.1.33175 WP_002020168.1.3318 WP_002020168.1.33338 WP_002020168.1.33367 WP_002020168.1.33740 WP_002020168.1.33828 WP_002020168.1.33876 WP_002020168.1.34158 WP_002020168.1.34646 WP_002020168.1.35153 WP_002020168.1.35255 WP_002020168.1.35518 WP_002020168.1.3561 WP_002020168.1.35684 WP_002020168.1.35886 WP_002020168.1.3615 WP_002020168.1.36305 WP_002020168.1.36763 WP_002020168.1.3699 WP_002020168.1.37093 WP_002020168.1.37626 WP_002020168.1.37990 WP_002020168.1.38036 WP_002020168.1.38425 WP_002020168.1.38517 WP_002020168.1.39001 WP_002020168.1.39781 WP_002020168.1.40550 WP_002020168.1.40839 WP_002020168.1.41165 WP_002020168.1.41365 WP_002020168.1.41675 WP_002020168.1.41976 WP_002020168.1.42165 WP_002020168.1.42217 WP_002020168.1.43104 WP_002020168.1.43533 WP_002020168.1.43762 WP_002020168.1.4439 WP_002020168.1.44449 WP_002020168.1.44463 WP_002020168.1.44483 WP_002020168.1.45089 WP_002020168.1.45305 WP_002020168.1.45385 WP_002020168.1.45533 WP_002020168.1.45919 WP_002020168.1.46236 WP_002020168.1.46244 WP_002020168.1.46476 WP_002020168.1.4649 WP_002020168.1.46549 WP_002020168.1.46746 WP_002020168.1.46864 WP_002020168.1.47097 WP_002020168.1.47145 WP_002020168.1.47441 WP_002020168.1.4763 WP_002020168.1.47644 WP_002020168.1.47798 WP_002020168.1.48010 WP_002020168.1.48164 WP_002020168.1.48311 WP_002020168.1.48599 WP_002020168.1.4865 WP_002020168.1.49056 WP_002020168.1.49428 WP_002020168.1.49802 WP_002020168.1.49831 WP_002020168.1.50316 WP_002020168.1.50514 WP_002020168.1.50770 WP_002020168.1.51087 WP_002020168.1.51167 WP_002020168.1.51335 WP_002020168.1.51656 WP_002020168.1.51749 WP_002020168.1.52494 WP_002020168.1.52756 WP_002020168.1.52794 WP_002020168.1.53137 WP_002020168.1.53493 WP_002020168.1.53621 WP_002020168.1.53683 WP_002020168.1.53879 WP_002020168.1.54117 WP_002020168.1.54189 WP_002020168.1.54775 WP_002020168.1.54782 WP_002020168.1.55057 WP_002020168.1.55788 WP_002020168.1.55811 WP_002020168.1.55958 WP_002020168.1.55968 WP_002020168.1.56042 WP_002020168.1.56055 WP_002020168.1.56176 WP_002020168.1.56270 WP_002020168.1.5628 WP_002020168.1.56318 WP_002020168.1.56580 WP_002020168.1.56959 WP_002020168.1.57203 WP_002020168.1.57245 WP_002020168.1.57565 WP_002020168.1.57815 WP_002020168.1.57859 WP_002020168.1.58037 WP_002020168.1.58160 WP_002020168.1.58335 WP_002020168.1.58814 WP_002020168.1.59052 WP_002020168.1.59095 WP_002020168.1.59173 WP_002020168.1.59310 WP_002020168.1.59575 WP_002020168.1.59773 WP_002020168.1.59978 WP_002020168.1.60274 WP_002020168.1.60402 WP_002020168.1.60781 WP_002020168.1.61213 WP_002020168.1.61231 WP_002020168.1.61944 WP_002020168.1.62107 WP_002020168.1.62300 WP_002020168.1.62918 WP_002020168.1.63137 WP_002020168.1.6340 WP_002020168.1.63560 WP_002020168.1.63611 WP_002020168.1.64377 WP_002020168.1.64491 WP_002020168.1.64615 WP_002020168.1.64706 WP_002020168.1.65758 WP_002020168.1.65983 WP_002020168.1.66331 WP_002020168.1.66357 WP_002020168.1.66932 WP_002020168.1.67108 WP_002020168.1.6716 WP_002020168.1.67239 WP_002020168.1.6753 WP_002020168.1.68607 WP_002020168.1.69203 WP_002020168.1.69323 WP_002020168.1.69894 WP_002020168.1.69970 WP_002020168.1.70018 WP_002020168.1.70065 WP_002020168.1.70645 WP_002020168.1.7096 WP_002020168.1.70996 WP_002020168.1.71441 WP_002020168.1.71648 WP_002020168.1.71895 WP_002020168.1.71953 WP_002020168.1.72514 WP_002020168.1.72704 WP_002020168.1.73325 WP_002020168.1.73329 WP_002020168.1.7398 WP_002020168.1.74226 WP_002020168.1.74337 WP_002020168.1.74538 WP_002020168.1.7545 WP_002020168.1.75499 WP_002020168.1.75870 WP_002020168.1.76125 WP_002020168.1.76783 WP_002020168.1.77370 WP_002020168.1.77576 WP_002020168.1.77668 WP_002020168.1.77690 WP_002020168.1.77824 WP_002020168.1.77902 WP_002020168.1.782 WP_002020168.1.7856 WP_002020168.1.78644 WP_002020168.1.79043 WP_002020168.1.79250 WP_002020168.1.79252 WP_002020168.1.79315 WP_002020168.1.79584 WP_002020168.1.79658 WP_002020168.1.79687 WP_002020168.1.80239 WP_002020168.1.80439 WP_002020168.1.80571 WP_002020168.1.80695 WP_002020168.1.80955 WP_002020168.1.80964 WP_002020168.1.81088 WP_002020168.1.81799 WP_002020168.1.82289 WP_002020168.1.82421 WP_002020168.1.82533 WP_002020168.1.82986 WP_002020168.1.83070 WP_002020168.1.83228 WP_002020168.1.83951 WP_002020168.1.84045 WP_002020168.1.84337 WP_002020168.1.8450 WP_002020168.1.85689 WP_002020168.1.85901 WP_002020168.1.86082 WP_002020168.1.86119 WP_002020168.1.86140 WP_002020168.1.86288 WP_002020168.1.8698 WP_002020168.1.87627 WP_002020168.1.8825 WP_002020168.1.88431 WP_002020168.1.8923 WP_002020168.1.89460 WP_002020168.1.89675 WP_002020168.1.90155 WP_002020168.1.90596 WP_002020168.1.90671 WP_002020168.1.90791 WP_002020168.1.90883 WP_002020168.1.91080 WP_002020168.1.91404 WP_002020168.1.91569 WP_002020168.1.9186 WP_002020168.1.92347 WP_002020168.1.92686 WP_002020168.1.92831 WP_002020168.1.93271 WP_002020168.1.93744 WP_002020168.1.93893 WP_002020168.1.93927 WP_002020168.1.93932 WP_002020168.1.94237 WP_002020168.1.94322 WP_002020168.1.94373 WP_002020168.1.94784 WP_002020168.1.95308 WP_002020168.1.95457 WP_002020168.1.95484 WP_002020168.1.95786 WP_002020168.1.96356 WP_002020168.1.96934 WP_002020168.1.97617 WP_002020168.1.97781 WP_002020168.1.97861 WP_002020168.1.98216 WP_002020168.1.98519 WP_002020168.1.98557 WP_002020168.1.98571 WP_002020168.1.99266 WP_002020168.1.99445 WP_002020168.1.99454 WP_002020168.1.99485 WP_002020168.1.99994 YP_026384.1.16718 YP_034450.1.62562 gi|384178004|ref|YP_005563766.1| gi|49479291|ref|YP_034450.1| gi|375282196|ref|YP_005102631.1| gi|386733964|ref|YP_006207145.1| gi|218901301|ref|YP_002449135.1| gi|402554315|ref|YP_006595586.1| gi|52145120|ref|YP_081709.1| gi|47525352|ref|YP_016701.1| gi|30260289|ref|NP_842666.1| gi|301051835|ref|YP_003790046.1| gi|227812771|ref|YP_002812780.1| IDP04579 gi|376264126|ref|YP_005116838.1| gi|222093868|ref|YP_002527918.1| 198094.BA_0098 222523.BCE_0098 260799.BAS0098 261594.GBAA0098 281309.BT9727_0094 288681.BCZK0092 361100.BCQ_0111 405534.BCAH187_A0128 405535.BCAH820_0109 568206.BAMEG_0113 572264.BCA_0126 592021.BAA_0113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]