SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330837044|ref|YP_004411685.1| from Sphaerochaeta coccoides DSM 17374

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330837044|ref|YP_004411685.1|
Domain Number 1 Region: 23-137,169-495
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.16e-139
Family GABA-aminotransferase-like 0.0000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330837044|ref|YP_004411685.1|
Sequence length 508
Comment serine hydroxymethyltransferase [Sphaerochaeta coccoides DSM 17374]
Sequence
MAVGKALQAYLDKRGTGEIEESMIAYVAALDMAAQVSPKIAGDIVNELADQRSHLKLIAS
ENFSSLTTQLSMGNLLTDKYSEGFPYHRFYAGCDNVDSIESYAVEKAKELFGAEHAYVQP
HSGADANLCAFWAILNQRVELPAYEEWGESNPANLGREKWEELRARFGSQKLLGLDYYSG
GHLTHGYRQNVSARMFDAYSYAVNPATGLLDYDAIERQAMDIKPLILLAGYSAYPRLINF
RRMGEIARKVGAVFMVDMAHFAGLVAGKVLTGDYDPVPWADIVTTTTHKTLRGPRGGLIL
CKKEFSESVDKGCPLVLGGPLPHVMAAKGIALTEALSPDFRSYAAKIVENSAALAAACIA
EGIPVATGGTDNHLMLLDVRPFGLNGRQAETQLRDCGITLNRNALPFDPNGPWYTSGLRI
GTPAVTTLGMGVPEMKKIASIIASVLKASHPLVLTKGANAGTTSKAKAETDPTVIVRARE
DVQTLLDAHPLYPELDLSFLRKFFPYVS
Download sequence
Identical sequences F4GKA7
WP_013739698.1.21038 gi|330837044|ref|YP_004411685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]