SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53711309|ref|YP_097301.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|53711309|ref|YP_097301.1|
Domain Number - Region: 107-195
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0441
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.028
Further Details:      
 
Domain Number - Region: 12-157
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0628
Family Calcium ATPase, transmembrane domain M 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53711309|ref|YP_097301.1|
Sequence length 208
Comment hypothetical protein [Bacteroides fragilis YCH46]
Sequence
MKIKKYCRYIHLWLSLPAGILISIICFTGAILVFKEELLTIMGYDSIRESPLMIVMKLHR
WLMDDTRTTGKMIVGISTLFFIFILISGLTVYWPRKWKKSRLIIEHQKGRRRLMFDLHSV
LGLYAALILLVCALTGLMWSFQWYRDIVSFIFDAEVKRGAPIWKIVRALHFGTYAGMFSK
IVTFIAALIGTSLPVTGYWMYLKRKKLL
Download sequence
Identical sequences A0A015Q6Q6 A0A015U0G4 A0A016C1N6 A0A016G767 A0A016GMY5 A0A0E2AWF4 A0A0E2RRU1 A0A0E2T1N5 A0A0K6BP99 A0A139TG84 F7LIX9 Q650Q7
WP_005797095.1.10040 WP_005797095.1.100686 WP_005797095.1.10083 WP_005797095.1.10405 WP_005797095.1.11335 WP_005797095.1.18542 WP_005797095.1.21107 WP_005797095.1.22050 WP_005797095.1.23698 WP_005797095.1.26260 WP_005797095.1.26934 WP_005797095.1.32651 WP_005797095.1.33107 WP_005797095.1.34692 WP_005797095.1.35533 WP_005797095.1.36984 WP_005797095.1.37988 WP_005797095.1.39779 WP_005797095.1.40326 WP_005797095.1.42362 WP_005797095.1.456 WP_005797095.1.46679 WP_005797095.1.48703 WP_005797095.1.49748 WP_005797095.1.5142 WP_005797095.1.51489 WP_005797095.1.51763 WP_005797095.1.53910 WP_005797095.1.53995 WP_005797095.1.57121 WP_005797095.1.58084 WP_005797095.1.60854 WP_005797095.1.6251 WP_005797095.1.63590 WP_005797095.1.66858 WP_005797095.1.66941 WP_005797095.1.69826 WP_005797095.1.73957 WP_005797095.1.7580 WP_005797095.1.76253 WP_005797095.1.89819 WP_005797095.1.91045 WP_005797095.1.93759 WP_005797095.1.95091 WP_005797095.1.95750 WP_005797095.1.97349 WP_005797095.1.97964 WP_005797095.1.98903 YP_097301.1.45732 gi|53711309|ref|YP_097301.1| 295405.BF0018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]