SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712608|ref|YP_098600.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712608|ref|YP_098600.1|
Domain Number 1 Region: 11-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.19e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.0029
Further Details:      
 
Domain Number 2 Region: 358-553
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.48e-23
Family Pyruvate oxidase and decarboxylase PP module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|53712608|ref|YP_098600.1|
Sequence length 555
Comment 2-oxoglutarate decarboxylase [Bacteroides fragilis YCH46]
Sequence
MYSDKKNILQLVALLRAHGVTKVVLCPGSRNAPIVHTLAGHPDFTCYSVTDERSAGFFAI
GLALQGGTPAAVCCTSGTALLNLHPAIAEAYYQKVSLVVISADRPAAWINQMDGQTLPQP
GVFRSLVKKSVDLPEIHTDEDEWYCNRLLNEALLELNHHGKGPVHINVPVSEPLFQFTAE
SLPEVRVITRYQGLNVYDRDYDGLIDRLNKYNRRMMIVGQMNLIYLFEKKYSKMLYKQFA
WFTEHLGNQTVPGIPIRNFDAALYAMSPEMQEKMIPELVITYGGHIVSKRMKKYLRQHPP
KEHWHVSPDGEVIDLFQGALTTIIEMDPFEFMEKIAFLLDNRTPEYPRQWENFCKELPRP
ELPYSEMSAIGSLIQALPASCALHLANSSAVRYAQLYSLPDTVEVCCNRGTSGIEGSLST
AIGYAAASKKLNFVVIGDLSFFYDMNALWNNHFGSNLRILLLNNGGGEIFHTLPGLEMSG
TSHRFVTAVHKTSAKGWAEERGFLYQEVQDEKQLDEAMKTFTQPELLTQPVIMEVFTNKN
KDARILKDYYHQLKN
Download sequence
Identical sequences A0A015S832 A0A015SFR0 A0A015TW26 A0A015VHM8 A0A015VZU3 A0A015YCB2 A0A016AM41 A0A016BY26 A0A016CH63 A0A016DL64 A0A016EPM8 A0A016HB63 A0A017NEM0 A0A017P6S4 A0A0E2ARZ9 A0A0E2SY27 A0A0E2TP74 A0A139T1H8 A0A149MY43 E1WRU2 I9BLM2 K1FU77 Q5LFS5 Q64WR0 R6ZPK3
gi|375357635|ref|YP_005110407.1| WP_005786027.1.10040 WP_005786027.1.100686 WP_005786027.1.101046 WP_005786027.1.10405 WP_005786027.1.15557 WP_005786027.1.18542 WP_005786027.1.2011 WP_005786027.1.21713 WP_005786027.1.21908 WP_005786027.1.22050 WP_005786027.1.23698 WP_005786027.1.26260 WP_005786027.1.26832 WP_005786027.1.30158 WP_005786027.1.30608 WP_005786027.1.31541 WP_005786027.1.32651 WP_005786027.1.33107 WP_005786027.1.34692 WP_005786027.1.35533 WP_005786027.1.37052 WP_005786027.1.37988 WP_005786027.1.38746 WP_005786027.1.39779 WP_005786027.1.40326 WP_005786027.1.40404 WP_005786027.1.4066 WP_005786027.1.42362 WP_005786027.1.43770 WP_005786027.1.43857 WP_005786027.1.44936 WP_005786027.1.46679 WP_005786027.1.48703 WP_005786027.1.49420 WP_005786027.1.49748 WP_005786027.1.50935 WP_005786027.1.51373 WP_005786027.1.5142 WP_005786027.1.51489 WP_005786027.1.51763 WP_005786027.1.52936 WP_005786027.1.53885 WP_005786027.1.53995 WP_005786027.1.54019 WP_005786027.1.56204 WP_005786027.1.57121 WP_005786027.1.58084 WP_005786027.1.60699 WP_005786027.1.60854 WP_005786027.1.6251 WP_005786027.1.63108 WP_005786027.1.63590 WP_005786027.1.63925 WP_005786027.1.65409 WP_005786027.1.65726 WP_005786027.1.65921 WP_005786027.1.66858 WP_005786027.1.66941 WP_005786027.1.69826 WP_005786027.1.73957 WP_005786027.1.75176 WP_005786027.1.75668 WP_005786027.1.7580 WP_005786027.1.76253 WP_005786027.1.77492 WP_005786027.1.78347 WP_005786027.1.81678 WP_005786027.1.85293 WP_005786027.1.87523 WP_005786027.1.88754 WP_005786027.1.89424 WP_005786027.1.89499 WP_005786027.1.91045 WP_005786027.1.91849 WP_005786027.1.93484 WP_005786027.1.93759 WP_005786027.1.9461 WP_005786027.1.94953 WP_005786027.1.95195 WP_005786027.1.95750 WP_005786027.1.97349 WP_005786027.1.97365 WP_005786027.1.97964 WP_005786027.1.98903 WP_005786027.1.9932 YP_098600.1.45732 gi|53712608|ref|YP_098600.1| 272559.BF1301 295405.BF1316 gi|60680819|ref|YP_210963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]