SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712912|ref|YP_098904.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712912|ref|YP_098904.1|
Domain Number 1 Region: 10-332
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.29e-73
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000243
Further Details:      
 
Domain Number 2 Region: 350-555
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.18e-43
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000538
Further Details:      
 
Domain Number 3 Region: 540-678
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.02e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53712912|ref|YP_098904.1|
Sequence length 678
Comment 2-oxoisovalerate dehydrogenase beta subunit [Bacteroides fragilis YCH46]
Sequence
MKKYDIKTTDEQTLRKWYHLMTLGRALDEKAPAYLLQSLGWSYHAPYAGHDGIQLAIGQV
FTLGEDYLFPYYRDMLTVLSAGMTPEELILNGISKATDPGSAGRHMSNHFAKPEWHIENI
SSATGTHDLHAAGVGRAMVYYGHKGVAITSHGESATSEGFVYEAINGASNERLPVIFVFQ
DNGYGISVPKKDQTANRKVADNFSGFKNLRIIHCNGKDVFDSMNAMTEAREFAIANRTPV
IVHANCVRIGSHSNSDKHTLYRDENELAYVKEADPLMKFRRMLLRYKRLTEEDLQQIEAA
AKKELAAANRKALAAPDPIPESIYDFVLPEPYIPQKYKDGLPGPVEGEKSFMVNAINETL
KEEFRRNPDTFIWGQDVANKDKGGVFNVTKGMQQEFGDARVFSAPIAEDYIVGTANGMCR
FDPKIHVVIEGAEFADYFWPAVEQYVECTHEYWRSNGKFTPNITLRLASGGYIGGGLYHS
QNLEGALTTLPGARIVCPSFADDAAGLLRTSMRSKGFTLYLEPKALYNSVEAAAVVPEEF
EVPFGKARIRREGTDLTIITYGNTTHFCLDVAERLAREEVGSVEVIDLRSLIPLDKEAIF
ASVRKTGKVMVVHEDKVFSGFGAEIAAQIAGEMFRYLDAPVQRVGSTFTPVGFNPILERA
ILPNDEKIYKAAKELLEF
Download sequence
Identical sequences Q64VV6
gi|53712912|ref|YP_098904.1| WP_011202503.1.76253 YP_098904.1.45732 295405.BF1622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]