SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712936|ref|YP_098928.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712936|ref|YP_098928.1|
Domain Number 1 Region: 23-241
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.11e-55
Family PFOR PP module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53712936|ref|YP_098928.1|
Sequence length 253
Comment ketoisovalerate oxidoreductase subunit VorA [Bacteroides fragilis YCH46]
Sequence
MTKEEIIKPENLVYKKPTLMNDNGMHYCPGCSHGVVHKLIAEVIEEMGLEDKAVGISPVG
CAVFIYNYLDIDWQEAAHGRAPALATAIKRLWPDRLVFTYQGDGDLACIGTAETIHALNR
GENITIIFINNAIYGMTGGQMAPTTLMGMKTATCPYGRDPELHGYPLKITEIAAQLEGTA
YVTRQSVQSVPAIRKAKKAIRKAFENSMNGKGSNLVEIVSTCSSGWKMTPEKANKWMEEH
MFPFYPLGDLKDK
Download sequence
Identical sequences A0A015P6T3 A0A015SX34 A0A015T5R2 A0A015U8R2 A0A015UQ95 A0A015WJQ4 A0A015Z2Y2 A0A016BQU9 A0A016BX48 A0A016CN54 A0A016CR05 A0A016I1V3 A0A016I4Q7 A0A017NDR4 A0A017P1K5 A0A0E2AQ22 A0A0E2AT93 A0A0E2RQ50 A0A0E2T0A1 A0A0E2T840 A0A139T7B8 A0A149N8P0 D1JKV0 E1WTW1 F7LNQ3 I9BKW6 K1FTE1 Q5LEU6 Q64VT2 R6YW43
gi|60681148|ref|YP_211292.1| 272559.BF1653 295405.BF1646 gi|53712936|ref|YP_098928.1| WP_005786495.1.10040 WP_005786495.1.100686 WP_005786495.1.101046 WP_005786495.1.10405 WP_005786495.1.11335 WP_005786495.1.15557 WP_005786495.1.18542 WP_005786495.1.2011 WP_005786495.1.21107 WP_005786495.1.21713 WP_005786495.1.21908 WP_005786495.1.22050 WP_005786495.1.23698 WP_005786495.1.26260 WP_005786495.1.26832 WP_005786495.1.26934 WP_005786495.1.30158 WP_005786495.1.30608 WP_005786495.1.31541 WP_005786495.1.32651 WP_005786495.1.33107 WP_005786495.1.34692 WP_005786495.1.35533 WP_005786495.1.35582 WP_005786495.1.36984 WP_005786495.1.37052 WP_005786495.1.37988 WP_005786495.1.38746 WP_005786495.1.39779 WP_005786495.1.40326 WP_005786495.1.4066 WP_005786495.1.42362 WP_005786495.1.43770 WP_005786495.1.43857 WP_005786495.1.44936 WP_005786495.1.456 WP_005786495.1.46679 WP_005786495.1.48703 WP_005786495.1.49420 WP_005786495.1.49748 WP_005786495.1.50677 WP_005786495.1.50935 WP_005786495.1.51373 WP_005786495.1.5142 WP_005786495.1.51489 WP_005786495.1.51763 WP_005786495.1.52936 WP_005786495.1.53885 WP_005786495.1.53910 WP_005786495.1.53995 WP_005786495.1.54019 WP_005786495.1.55270 WP_005786495.1.56204 WP_005786495.1.57121 WP_005786495.1.58084 WP_005786495.1.60699 WP_005786495.1.60854 WP_005786495.1.6251 WP_005786495.1.63108 WP_005786495.1.63590 WP_005786495.1.63925 WP_005786495.1.65409 WP_005786495.1.65726 WP_005786495.1.65921 WP_005786495.1.66858 WP_005786495.1.66941 WP_005786495.1.69826 WP_005786495.1.73957 WP_005786495.1.75668 WP_005786495.1.7580 WP_005786495.1.76253 WP_005786495.1.78347 WP_005786495.1.81678 WP_005786495.1.85293 WP_005786495.1.87523 WP_005786495.1.88754 WP_005786495.1.89499 WP_005786495.1.89819 WP_005786495.1.91045 WP_005786495.1.91849 WP_005786495.1.93484 WP_005786495.1.93759 WP_005786495.1.9461 WP_005786495.1.94953 WP_005786495.1.95091 WP_005786495.1.95750 WP_005786495.1.97349 WP_005786495.1.97964 WP_005786495.1.98903 YP_098928.1.45732 gi|375357956|ref|YP_005110728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]