SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712938|ref|YP_098930.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712938|ref|YP_098930.1|
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.13e-58
Family PFOR Pyr module 0.01
Further Details:      
 
Domain Number 2 Region: 248-356
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.06e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|53712938|ref|YP_098930.1|
Sequence length 360
Comment ketoisovalerate oxidoreductase subunit VorB [Bacteroides fragilis YCH46]
Sequence
MAEEVVLMKGNEAIAHAAIRCGADGYFGYPITPQSEVLETLAELRPWETTGMVVLQAESE
VAAINMVYGGAGSGKMVMTSSSSPGVSLKQEGISYLAGAELPCLIVNVMRGGPGLGTIQP
SQADYFQTVKGGGHGDYKLIALAPASVQEMADFVGLAFELAFKYRNPAIILADGVIGQMM
EKVVLPPAKARRTDAEVIAQCPWASTGKTKDRKPNIITSLELRPEEMEKNNLRFQAKYRV
IEENEVRFEEIDCEDAEYLIVAFGSMARIGQKAMELAREEGIKVGMLRPITLWPFPTKAI
AEYANKVKGMLVTELNAGQMVEDVRLAVNGRVKVEHFGRLGGIVPDPDEIVTALKEQLIK
Download sequence
Identical sequences A0A015QYV3 A0A015SRJ4 A0A015TWH3 A0A015UA44 A0A015VGX0 A0A015WD55 A0A015WF25 A0A015YLJ2 A0A016ALJ7 A0A016EHI9 A0A016ENQ7 A0A016JMK9 A0A017NEM3 A0A017NZK3 A0A0E2ADZ8 A0A0E2RTV4 A0A0E2TC66 A0A0E2TE39 A0A0K6BSV6 A0A139T7B3 D1JKV2 E1WTW3 F7LNQ5 I9KKB7 K1G3T2 Q5LEU4 Q64VT0 R6YQ78
WP_005786497.1.10040 WP_005786497.1.100686 WP_005786497.1.10083 WP_005786497.1.101046 WP_005786497.1.10405 WP_005786497.1.15557 WP_005786497.1.18542 WP_005786497.1.2011 WP_005786497.1.21107 WP_005786497.1.21713 WP_005786497.1.21908 WP_005786497.1.22050 WP_005786497.1.23698 WP_005786497.1.26260 WP_005786497.1.26832 WP_005786497.1.26934 WP_005786497.1.30158 WP_005786497.1.30608 WP_005786497.1.31541 WP_005786497.1.32651 WP_005786497.1.33107 WP_005786497.1.34692 WP_005786497.1.35533 WP_005786497.1.35582 WP_005786497.1.35818 WP_005786497.1.36984 WP_005786497.1.37052 WP_005786497.1.37988 WP_005786497.1.38746 WP_005786497.1.39779 WP_005786497.1.40326 WP_005786497.1.40404 WP_005786497.1.4066 WP_005786497.1.42362 WP_005786497.1.43770 WP_005786497.1.43857 WP_005786497.1.44936 WP_005786497.1.456 WP_005786497.1.46679 WP_005786497.1.48703 WP_005786497.1.49420 WP_005786497.1.49748 WP_005786497.1.50935 WP_005786497.1.51373 WP_005786497.1.5142 WP_005786497.1.51489 WP_005786497.1.51763 WP_005786497.1.52936 WP_005786497.1.53885 WP_005786497.1.53910 WP_005786497.1.53995 WP_005786497.1.54019 WP_005786497.1.55270 WP_005786497.1.56204 WP_005786497.1.57121 WP_005786497.1.58084 WP_005786497.1.60699 WP_005786497.1.60854 WP_005786497.1.6251 WP_005786497.1.63108 WP_005786497.1.63590 WP_005786497.1.63925 WP_005786497.1.65409 WP_005786497.1.65726 WP_005786497.1.65921 WP_005786497.1.66858 WP_005786497.1.66941 WP_005786497.1.69826 WP_005786497.1.73957 WP_005786497.1.75176 WP_005786497.1.75668 WP_005786497.1.7580 WP_005786497.1.76253 WP_005786497.1.77492 WP_005786497.1.78347 WP_005786497.1.81678 WP_005786497.1.85293 WP_005786497.1.87523 WP_005786497.1.88754 WP_005786497.1.89424 WP_005786497.1.89499 WP_005786497.1.91045 WP_005786497.1.91849 WP_005786497.1.93484 WP_005786497.1.93759 WP_005786497.1.9461 WP_005786497.1.94953 WP_005786497.1.95091 WP_005786497.1.95195 WP_005786497.1.95750 WP_005786497.1.97349 WP_005786497.1.97365 WP_005786497.1.97964 WP_005786497.1.98903 WP_005786497.1.9932 YP_098930.1.45732 272559.BF1656 295405.BF1648 gi|53712938|ref|YP_098930.1| gi|60681150|ref|YP_211294.1| gi|375357958|ref|YP_005110730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]