SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712942|ref|YP_098934.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712942|ref|YP_098934.1|
Domain Number 1 Region: 2-324
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.3e-87
Family TK-like PP module 0.00000441
Further Details:      
 
Domain Number 2 Region: 345-533
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.1e-46
Family TK-like Pyr module 0.0000477
Further Details:      
 
Domain Number 3 Region: 539-669
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.22e-32
Family Transketolase C-terminal domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|53712942|ref|YP_098934.1|
Sequence length 669
Comment transketolase [Bacteroides fragilis YCH46]
Sequence
MNDSKLMNRAADNIRILAASMVEKANSGHPGGAMGGADFVNVLFSEFLVYDPQNPRWEGR
DRFFLDPGHMSPMLYSVLAFTGKYTLDELKQFRQWGSPTPGHPEVNVDRGVENTSGPLGQ
GHTYAVGAAIAAKFLKARFGEVMNQTIYAYISDGGIQEEISQGAGRIAGTLGLDNLIMFY
DSNDVQLSTNTEDVTTENVAMKYEAWDWKVITINGNDPDEIRKALTEAKAEKNRPTLIIG
KTTMGKGARRADGSSYEADCATHGAPLGGDAYVNTIKNLGGNPENPFTIFPEVAELYAKR
AEELKKIVADKYAAKAEWAKANPEKAAKLAEFFSGKAPKVNWDAIEQKAGGATRAGSATV
LGALATQVENMIVSSADLSNSDKTDGFLKKTHAFKKGDFSGAFLQAGVSELSMACICIGM
SLHGGIIAACGTFFVFSDYMKPALRMAALMEQPVKFIWTHDAFRVGEDGPTHEPVEQEAQ
VRLLEKLKNHKGHNSMLVLRPADVEETTIAWKLAMENMSTPTALILSRQNIVNLPAGTDY
SQAAKGAYIIADADENPDVILVASGSEVSTLVAGAELLRKEGVKVRIVSAPSEGLFRNQS
KEYQESILPAGAKIFGLTAGLPVNLEGLVGSNGKVFGLESFGFSAPYKVLDEKLGFTAEN
VYNQVKAML
Download sequence
Identical sequences A0A015VGY9 A0A015WD61 A0A016ALK2 A0A016CN56 A0A017NEM8 A0A017NZK9 A0A0E2ADG4 A0A0E2B3J1 A0A0E2RTV8 A0A0K6BSL9 A0A139T700 E1WTW7 F7LNQ9 Q5LEU0 Q64VS6
gi|375357962|ref|YP_005110734.1| gi|60681154|ref|YP_211298.1| gi|53712942|ref|YP_098934.1| 272559.BF1660 295405.BF1652 WP_005786503.1.100686 WP_005786503.1.10083 WP_005786503.1.11335 WP_005786503.1.15557 WP_005786503.1.18542 WP_005786503.1.2011 WP_005786503.1.21107 WP_005786503.1.21908 WP_005786503.1.22050 WP_005786503.1.23698 WP_005786503.1.26260 WP_005786503.1.26934 WP_005786503.1.30158 WP_005786503.1.30608 WP_005786503.1.32651 WP_005786503.1.34692 WP_005786503.1.35533 WP_005786503.1.35582 WP_005786503.1.36984 WP_005786503.1.37052 WP_005786503.1.37988 WP_005786503.1.38746 WP_005786503.1.40326 WP_005786503.1.4066 WP_005786503.1.42362 WP_005786503.1.43770 WP_005786503.1.43857 WP_005786503.1.456 WP_005786503.1.46679 WP_005786503.1.48703 WP_005786503.1.50677 WP_005786503.1.50935 WP_005786503.1.5142 WP_005786503.1.51489 WP_005786503.1.51763 WP_005786503.1.53885 WP_005786503.1.53910 WP_005786503.1.56204 WP_005786503.1.57121 WP_005786503.1.58084 WP_005786503.1.60854 WP_005786503.1.6251 WP_005786503.1.63590 WP_005786503.1.65409 WP_005786503.1.65726 WP_005786503.1.65921 WP_005786503.1.66858 WP_005786503.1.66941 WP_005786503.1.69826 WP_005786503.1.73957 WP_005786503.1.75668 WP_005786503.1.76253 WP_005786503.1.81678 WP_005786503.1.85293 WP_005786503.1.87523 WP_005786503.1.88754 WP_005786503.1.89819 WP_005786503.1.91045 WP_005786503.1.91849 WP_005786503.1.93759 WP_005786503.1.9461 WP_005786503.1.94953 WP_005786503.1.95091 WP_005786503.1.95750 WP_005786503.1.97964 WP_005786503.1.98903 YP_098934.1.45732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]