SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53712984|ref|YP_098976.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53712984|ref|YP_098976.1|
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.24e-50
Family Pyruvate oxidase and decarboxylase Pyr module 0.02
Further Details:      
 
Domain Number 2 Region: 346-519
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.3e-23
Family Pyruvate oxidase and decarboxylase PP module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53712984|ref|YP_098976.1|
Sequence length 530
Comment indolepyruvate oxidoreductase subunit IorA [Bacteroides fragilis YCH46]
Sequence
MSKQLLLGDEAIAQAALDAGLSGVYAYPGTPSTEITEYIQMAPITSERNIHNRWCANEKT
AMEAALGMSFVGKRALVCMKHVGMNVAADCFINSAITGVKGGLIVVAADDPSMHSSQNEQ
DSRFYGDFSLIPMYEPSNQQEAYDMVYNGFEFSEKIGEPILMRMVTRLAHSRSGVENKAQ
KPQNEISFSEDPRQFILLPGNARKRYKVLLTRQEEFIKASEESPYNRYIDGPNKKTGIVA
CGIGYNYLMENYPEGCEYPVLKVGQYPLPKKQLMQLIDACDEILVLEDGQPFVEKQLKGY
LGIGLKVKGRLDGTLSQDGELNPDTVARALGKESSSEFNVPNIVEMRPPALCEGCGHRDM
YITLTQVLKEEYPTHKVFSDIGCYTLGANAPFNAINSCVDMGASITMAKGASDGGLHPAV
AVIGDSTFTHSGMTGLLDCVNENANVTIVISDNETTAMTGGQDSAGTGRLEAICAGLGVD
PAHIRVVVPLKKNYEEMKQIIREEINYKGVSVIIPRRECIQTLARKKRSK
Download sequence
Identical sequences Q64VN4
gi|53712984|ref|YP_098976.1| 295405.BF1695 YP_098976.1.45732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]