SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53713122|ref|YP_099114.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53713122|ref|YP_099114.1|
Domain Number 1 Region: 179-371
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-36
Family Pyruvate oxidase and decarboxylase PP module 0.0043
Further Details:      
 
Domain Number 2 Region: 5-170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-23
Family Pyruvate oxidase and decarboxylase Pyr module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53713122|ref|YP_099114.1|
Sequence length 378
Comment putative phosphoenolpyruvate decarboxylase [Bacteroides fragilis YCH46]
Sequence
MVSVEKIYDTFLHHGVDFFTGVPDSLLKNICAYITDHAPRGKHIIAANEGSAVGIACGYY
MASGNVPLVYMQNSGLGNTVNPLLSLADEKVYSLPLLLLVGWRGEPGTKDEPQHKKQGEV
TLDLLKAMKIPFIILDTDEDEALAQIHDAVVSAKSRSIPHAIVIRKDTFGKYKLRQEALN
DYPLSREEALMQVVDHLGDNDIVVSTTGKLSRELFEYRESKGQGHARDFLTVGSMGHSSS
IALGIALEKPDRRVYCLDGDGAFIMHMGAVSNIGDLSPKNYRHVLFNNGAHESVGGQPTL
GFRLDIASIAKGCGYAHVLTASDKEGLSCALEKLSGLSGPVLLEIKVRIDSRDDLGRPTT
TPVENKEHFMAFLKDTHS
Download sequence
Identical sequences A0A015YAC1 A0A016DIV0 A0A017P337 A0A0E2TCP2 A0A139T903 K1G2L0 Q5LE56 Q64V98 Q9F764
272559.BF1898 295405.BF1833 WP_005817136.1.10083 WP_005817136.1.101046 WP_005817136.1.15557 WP_005817136.1.2011 WP_005817136.1.21713 WP_005817136.1.26832 WP_005817136.1.30608 WP_005817136.1.31541 WP_005817136.1.35582 WP_005817136.1.37988 WP_005817136.1.4066 WP_005817136.1.42362 WP_005817136.1.43770 WP_005817136.1.50935 WP_005817136.1.51373 WP_005817136.1.51763 WP_005817136.1.52936 WP_005817136.1.54019 WP_005817136.1.57121 WP_005817136.1.58084 WP_005817136.1.6251 WP_005817136.1.63925 WP_005817136.1.65409 WP_005817136.1.65726 WP_005817136.1.69826 WP_005817136.1.75668 WP_005817136.1.76253 WP_005817136.1.91849 WP_005817136.1.93759 WP_005817136.1.95195 WP_005817136.1.95750 WP_005817136.1.98903 YP_099114.1.45732 gi|60681388|ref|YP_211532.1| gi|53713122|ref|YP_099114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]