SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53714675|ref|YP_100667.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53714675|ref|YP_100667.1|
Domain Number 1 Region: 358-563
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.38e-63
Family Pyruvate oxidase and decarboxylase PP module 0.00045
Further Details:      
 
Domain Number 2 Region: 4-169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.04e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.00007
Further Details:      
 
Domain Number 3 Region: 185-351
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.7e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53714675|ref|YP_100667.1|
Sequence length 579
Comment pyruvate dehydrogenase [Bacteroides fragilis YCH46]
Sequence
MAKKVAEQLVDTLIEAGVRRIYAVTGDSLNEVNEAVRQNEAMKWIHVRHEETGAYAAGAE
AQLTGLPGCCAGSSGPGHVHLINGLYDAHRSGAPVIAIASTIPTGEFGTEYFQETNTVKL
FNDCSFYNEVATTPEQFPRMLQSALQTATTRKGVAVVGLPGDLAKKPAVKVESSEQIYPL
ASSVCPAEEDLIRLAGMLNHYERITLFCGIGCKGAHEEIIRMSETLNAPVAYTFKGKMEV
QYDNPYEVGMTGLLGMPSGYYSMHEAEVLVMLGTDFPYSAFLPDDIKIVQVDIKPERLGR
RAKVDLGLCGDVRSTLRALLPMLQQKKNDSFLRKQLKRYEGVKKDLAAYTEDKGKMDQIH
PEYVMSEINNISSDDAIYTVDTGMTCVWGARYLQATGKRHMLGSFNHGSMANALPQAIGA
ALACPDRQVIALCGDGGLSMTLGDLETVVQYKLPIKIIVFNNRSLGMVKLEMEVDGLPDW
QTDMLNPNFAQVAEAMGMTGFNVSDPEEVLNTLCNAFELEGPVLINVMTDPNALAMPPKI
ELGQMVGFAQSMYKLLINGRSQEVIDTINSNFKHIREVF
Download sequence
Identical sequences A0A015PYJ0 A0A015SG88 A0A015ST43 A0A015TYU6 A0A015UKK1 A0A015WAD5 A0A015YYH5 A0A016E532 A0A016E787 A0A016GDA7 A0A017N7Q3 A0A017NES2 A0A0E2ABB4 A0A0E2AM76 A0A0E2RKI9 A0A0E2TAG8 A0A0E2TMJ6 D1JSF2 E1WUF9 F7LUM4 Q64QU8 R6ZRB6
295405.BF3389 gi|53714675|ref|YP_100667.1| gi|375359482|ref|YP_005112254.1| WP_005789735.1.10083 WP_005789735.1.10405 WP_005789735.1.11335 WP_005789735.1.15557 WP_005789735.1.18542 WP_005789735.1.2011 WP_005789735.1.21107 WP_005789735.1.21713 WP_005789735.1.21908 WP_005789735.1.22050 WP_005789735.1.26260 WP_005789735.1.26832 WP_005789735.1.26934 WP_005789735.1.30158 WP_005789735.1.30608 WP_005789735.1.32651 WP_005789735.1.34692 WP_005789735.1.35533 WP_005789735.1.35582 WP_005789735.1.35818 WP_005789735.1.36984 WP_005789735.1.37052 WP_005789735.1.38746 WP_005789735.1.39779 WP_005789735.1.40326 WP_005789735.1.40404 WP_005789735.1.4066 WP_005789735.1.42362 WP_005789735.1.43770 WP_005789735.1.43857 WP_005789735.1.456 WP_005789735.1.49420 WP_005789735.1.49748 WP_005789735.1.50677 WP_005789735.1.50935 WP_005789735.1.51373 WP_005789735.1.5142 WP_005789735.1.51489 WP_005789735.1.51763 WP_005789735.1.52936 WP_005789735.1.53885 WP_005789735.1.53910 WP_005789735.1.54019 WP_005789735.1.55270 WP_005789735.1.56204 WP_005789735.1.65409 WP_005789735.1.65726 WP_005789735.1.65921 WP_005789735.1.66858 WP_005789735.1.66941 WP_005789735.1.73957 WP_005789735.1.75176 WP_005789735.1.75668 WP_005789735.1.7580 WP_005789735.1.76253 WP_005789735.1.77492 WP_005789735.1.85293 WP_005789735.1.87523 WP_005789735.1.88754 WP_005789735.1.89424 WP_005789735.1.89819 WP_005789735.1.91849 WP_005789735.1.93484 WP_005789735.1.93759 WP_005789735.1.9461 WP_005789735.1.94953 WP_005789735.1.95091 WP_005789735.1.95195 WP_005789735.1.97365 WP_005789735.1.97964 WP_005789735.1.98903 WP_005789735.1.9932 YP_100667.1.45732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]