SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53715046|ref|YP_101038.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53715046|ref|YP_101038.1|
Domain Number 1 Region: 371-563
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000165
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.61e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000535
Further Details:      
 
Domain Number 3 Region: 190-350
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.13e-54
Family Pyruvate oxidase and decarboxylase, middle domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53715046|ref|YP_101038.1|
Sequence length 565
Comment acetolactate synthase large subunit [Bacteroides fragilis YCH46]
Sequence
MSKDIISGGEALMRSLEYHGVKTIFGYPGGSIMPVFDALYDHRETLNHILVRHEQGAAHA
AQGFARASGEVGVCLVTSGPGATNTITGIADAMIDSTPIVVIAGQVGTAFLGTDAFQEVD
LVGITQPITKWSYQIRRAEDVPWAVARAFYIAKSGRPGPVVLDFAKNAQVEKAEYMPAKL
DFIRSYVPVPETDPEAVKAAAELINGAERPLVLVGQGVELGNAQQELRAFIEKADMPAGC
TLLGLSALPTEHPLNKGMLGMHGNLGPNMNTNKCDVLIAVGMRFDDRVTGNLATYAKQAK
VIHFDIDPAEINKNVHADVAVLGNCKETLSAVTALLQPNEHKEWLDSFLPYEQVEEEKVI
RPELHPMGDTLSMGEVVRAVSDATNHEAILVTDVGQNQMMSARYFKYSKDRSMITSGGLG
TMGFGLPAAIGATFGRPDRTVCVFMGDGGLQMNIQELGTIMEQKAPVKIIVLNNNFLGNV
RQWQAMFFNRKYSFTPMLNPDYIKIASAYDIPAKRVFTREELADAIDEMIATDGPFLLEA
CVIEEGNVLPMTPPGGSVNQMLLEC
Download sequence
Identical sequences A0A015SF29 A0A015SLP6 A0A015TS80 A0A015V6Y7 A0A015VT58 A0A015XDP6 A0A016AFG5 A0A016BR76 A0A016FVF3 A0A016FXP5 A0A017N3J3 A0A017N9Y7 A0A0E2A8L8 A0A0E2AN80 A0A0E2RN57 A0A0E2T8L9 A0A0K6BYE7 A0A0M4BTV3 A0A139T3Q8 E1WWB3 F7LSM5 K1GJU6 Q5L9I9 Q64PS7 R6ZNA5
gi|60683008|ref|YP_213152.1| 272559.BF3550 295405.BF3762 WP_005790701.1.10040 WP_005790701.1.100686 WP_005790701.1.10083 WP_005790701.1.101046 WP_005790701.1.10405 WP_005790701.1.11335 WP_005790701.1.15557 WP_005790701.1.18542 WP_005790701.1.2011 WP_005790701.1.21107 WP_005790701.1.21713 WP_005790701.1.21908 WP_005790701.1.22050 WP_005790701.1.23698 WP_005790701.1.26260 WP_005790701.1.26832 WP_005790701.1.26934 WP_005790701.1.30158 WP_005790701.1.31541 WP_005790701.1.32651 WP_005790701.1.33107 WP_005790701.1.34692 WP_005790701.1.35533 WP_005790701.1.35818 WP_005790701.1.36984 WP_005790701.1.37052 WP_005790701.1.37988 WP_005790701.1.38746 WP_005790701.1.39779 WP_005790701.1.40326 WP_005790701.1.40404 WP_005790701.1.4066 WP_005790701.1.42362 WP_005790701.1.43770 WP_005790701.1.43857 WP_005790701.1.456 WP_005790701.1.46679 WP_005790701.1.48703 WP_005790701.1.49420 WP_005790701.1.49748 WP_005790701.1.50677 WP_005790701.1.50935 WP_005790701.1.51373 WP_005790701.1.5142 WP_005790701.1.51489 WP_005790701.1.51763 WP_005790701.1.52936 WP_005790701.1.53885 WP_005790701.1.53910 WP_005790701.1.53995 WP_005790701.1.54019 WP_005790701.1.56204 WP_005790701.1.57121 WP_005790701.1.58084 WP_005790701.1.60699 WP_005790701.1.60854 WP_005790701.1.6251 WP_005790701.1.63590 WP_005790701.1.63925 WP_005790701.1.65409 WP_005790701.1.65726 WP_005790701.1.65921 WP_005790701.1.66858 WP_005790701.1.66941 WP_005790701.1.69826 WP_005790701.1.73957 WP_005790701.1.75176 WP_005790701.1.75668 WP_005790701.1.7580 WP_005790701.1.76253 WP_005790701.1.77492 WP_005790701.1.78347 WP_005790701.1.81678 WP_005790701.1.85293 WP_005790701.1.87523 WP_005790701.1.88754 WP_005790701.1.89424 WP_005790701.1.89819 WP_005790701.1.91045 WP_005790701.1.91849 WP_005790701.1.93484 WP_005790701.1.93759 WP_005790701.1.9461 WP_005790701.1.94953 WP_005790701.1.95091 WP_005790701.1.95195 WP_005790701.1.95750 WP_005790701.1.97349 WP_005790701.1.97365 WP_005790701.1.97964 WP_005790701.1.98903 WP_005790701.1.9932 YP_101038.1.45732 gi|53715046|ref|YP_101038.1| gi|375359792|ref|YP_005112564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]