SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53715588|ref|YP_101580.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53715588|ref|YP_101580.1|
Domain Number 1 Region: 1-303
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.14e-60
Family TK-like PP module 0.039
Further Details:      
 
Domain Number 2 Region: 251-435
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.58e-38
Family TK-like Pyr module 0.032
Further Details:      
 
Domain Number 3 Region: 452-581
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-19
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53715588|ref|YP_101580.1|
Sequence length 586
Comment 1-deoxyxylulose-5-phosphate synthase [Bacteroides fragilis YCH46]
Sequence
MYIEKINSPKDIKELSVEQLSVLAEEVRTALIRKLSEHGGHIGPNLGMVETTIALHYVFN
SPIDKIVFDVSHQSYVHKMLTGRMAAFLDPAKYDDVTGYTNPDESEHDFFTIGHTSTSVS
LAMGLAKGRDLIGGKENIIAVIGDGSLSGGEALEGLNNAAMLGSNMIIIVNDNDQSIAEN
HGGLYKGLKELRDTNGESPDNIFKAMGLEYYYLGDGHDVSALIKLFTSVKDIDRAVVLHI
HTIKGKGLKYAEENKEYWHAGGPFHIEDGSPKGPGWPVNETVRESVLDLIEKRSDVVAIT
AGTPSVIGFTEDYRKRAGKQFVDVGIAEEHAVAMASGIARNGGTPIFGVFSPFLQRTYDQ
LSSDLCLNNNPAVIMVFMASVYGMNSNTHLGIYDIPMISHIPNLVYLAPTSKEEYLAMFK
YATTQKAHPIAIRIPMMMPETGIEDTTDYSLLNKYQVVRKGSGVAIIALGDFFELGVQIA
DKYKILTGNDVTLINPKFITGIDEELLECLKTDHELVLTLEDGIVEGGFGQTIASFYGLS
DMKVKNYGIKKSFPTDFRPEELMRENGLSVEQIIEDIKSVCREHVM
Download sequence
Identical sequences Q64N89
gi|53715588|ref|YP_101580.1| 295405.BF4306 YP_101580.1.45732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]