SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53715720|ref|YP_101712.1| from Bacteroides fragilis YCH46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53715720|ref|YP_101712.1|
Domain Number 1 Region: 4-336
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.67e-80
Family Pyruvate oxidase and decarboxylase PP module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53715720|ref|YP_101712.1|
Sequence length 336
Comment 2-oxoglutarate synthase subunit KorB [Bacteroides fragilis YCH46]
Sequence
MSETVYTAKDYKSGQPRWCPGCGDHAFLNSLHKAMAELGVAPHNIAVISGIGCSSRLPYY
VNTYGFHTIHGRAAAVATGAKVANPDLTIWQISGDGDGLAIGGNHFIHAVRRNIDLNMIL
LNNRIYGLTKGQYSPTSDRGFVSKSSPYGTVEDPFHPAELCFGARGRFFARCVAVDGPAS
VEVLKAAANHKGASVVEVLQNCVIFNDGTHESVATKEGRSKNAIYLEHGKPMLFGENKEF
GLMQEGFGLKVVKLGENGVTEKDILIHNAHSMDNTLQLKLALMEGPDFPIALGVIRDVEA
PTYNDAVAEQIDEVKAKKKYHNFQELLMTNETWEVK
Download sequence
Identical sequences A0A015P916 A0A015SYP6 A0A015TBC3 A0A015U0V3 A0A015UEV0 A0A015V8V7 A0A015WCK4 A0A015X3V9 A0A016CIE2 A0A016DG21 A0A016G3L0 A0A017N1A9 A0A017N4B1 A0A0E2A6F2 A0A0E2ALB1 A0A0E2RHD5 A0A0E2ST67 A0A0E2T5I7 A0A0K6BZR5 A0A139SYS1 D1JWB0 E1WRG6 F7LVG9 K1FX06 Q5L7N9 Q64MV9 R6ZLB2
WP_005791975.1.100686 WP_005791975.1.10083 WP_005791975.1.101046 WP_005791975.1.10405 WP_005791975.1.11335 WP_005791975.1.15557 WP_005791975.1.18542 WP_005791975.1.2011 WP_005791975.1.21107 WP_005791975.1.21713 WP_005791975.1.21908 WP_005791975.1.22050 WP_005791975.1.23698 WP_005791975.1.26260 WP_005791975.1.26832 WP_005791975.1.26934 WP_005791975.1.30158 WP_005791975.1.30608 WP_005791975.1.36984 WP_005791975.1.37052 WP_005791975.1.37988 WP_005791975.1.38746 WP_005791975.1.39779 WP_005791975.1.40326 WP_005791975.1.40404 WP_005791975.1.4066 WP_005791975.1.42362 WP_005791975.1.43770 WP_005791975.1.43857 WP_005791975.1.456 WP_005791975.1.46679 WP_005791975.1.48703 WP_005791975.1.49420 WP_005791975.1.50677 WP_005791975.1.50935 WP_005791975.1.51373 WP_005791975.1.52936 WP_005791975.1.53885 WP_005791975.1.53910 WP_005791975.1.54019 WP_005791975.1.55270 WP_005791975.1.56204 WP_005791975.1.58084 WP_005791975.1.60699 WP_005791975.1.60854 WP_005791975.1.6251 WP_005791975.1.63590 WP_005791975.1.63925 WP_005791975.1.65409 WP_005791975.1.65726 WP_005791975.1.65921 WP_005791975.1.75176 WP_005791975.1.75668 WP_005791975.1.7580 WP_005791975.1.76253 WP_005791975.1.77492 WP_005791975.1.78347 WP_005791975.1.81678 WP_005791975.1.85293 WP_005791975.1.87523 WP_005791975.1.88754 WP_005791975.1.89424 WP_005791975.1.89819 WP_005791975.1.91045 WP_005791975.1.91849 WP_005791975.1.93484 WP_005791975.1.9461 WP_005791975.1.94953 WP_005791975.1.95091 WP_005791975.1.95195 WP_005791975.1.95750 WP_005791975.1.97365 WP_005791975.1.97964 WP_005791975.1.9932 YP_101712.1.45732 gi|53715720|ref|YP_101712.1| APC62153 272559.BF4240 295405.BF4441 gi|60683658|ref|YP_213802.1| gi|375360489|ref|YP_005113261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]