SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883323|ref|YP_002427705.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883323|ref|YP_002427705.1|
Domain Number 1 Region: 182-276
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000327
Family Multidrug resistance efflux transporter EmrE 0.031
Further Details:      
 
Weak hits

Sequence:  gi|218883323|ref|YP_002427705.1|
Domain Number - Region: 40-140
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0144
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883323|ref|YP_002427705.1|
Sequence length 284
Comment Permease of the drug/metabolite transporter (DMT) superfamily [Desulfurococcus kamchatkensis 1221n]
Sequence
MNKRVAGVVSLVVATILWGSSFSFIKLSVTDVSPLTYSSLRSFIAVILLTPIILLKMYRG
VLSINSLYKGFIVGIAYFLGLFLQAAGTVYTTPSLSAFITGLNSVHVHLYIALVERNYGL
IDGIALLLALSGLYVLTSPSGGLTIGVLLIFIGSIAWAAQIILVSRYGSSSIIEILYGMF
LPGALTYPFALILGGAVGIEALIYITYLAVACSVLATFFQVWGQRYVSPLTAALIFLLEP
VFALLFSLAMGLEGIEPYKVIGGGLIVIATYLSSMAELSSNWLK
Download sequence
Identical sequences B8D367
WP_012607680.1.40753 gi|218883323|ref|YP_002427705.1| 490899.DKAM_0009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]