SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883519|ref|YP_002427901.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883519|ref|YP_002427901.1|
Domain Number 1 Region: 40-97
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.89e-16
Family Short-chain ferredoxins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218883519|ref|YP_002427901.1|
Sequence length 160
Comment 4Fe-4S ferredoxin, iron-sulfur binding domain-containing protein [Desulfurococcus kamchatkensis 1221n]
Sequence
MSSKRTGIITKEELVEKKLLPSMERLSNGPIAILECPEEIPCNICVSACPFNAISKSRIY
EVPRLNPDKCIGCGVCVGKCPGLAIFVVDLSKPGKAYVTLPYEMLPSPSKGARVELLDRE
GRVIGEGTVVKAWVYEKTWVVTVEVPGDLWFDVRAVRIVR
Download sequence
Identical sequences B8D2Y7
WP_012607876.1.1384 WP_012607876.1.40753 490899.DKAM_0208 gi|218883519|ref|YP_002427901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]