SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218883522|ref|YP_002427904.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883522|ref|YP_002427904.1|
Domain Number 1 Region: 25-144
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.83e-30
Family Molybdopterin synthase subunit MoaE 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218883522|ref|YP_002427904.1|
Sequence length 158
Comment MoaD family protein [Desulfurococcus kamchatkensis 1221n]
Sequence
MCYIEAKLLESGEKILLDELIGKLSAMDKNHGNGALSIFVGLVKGELNEARVHELEYTAI
SEVAAKRLEEIARDICTKYSLSAVVIYHRLGRLKPGETTIYIVTMGTSRKNTNPAMIEAL
ERVKKEVPVFKLEKRSDGEYWVIGDGVRYRRTLTPSPS
Download sequence
Identical sequences B8D2Z0 I3XQH2
WP_012607879.1.2099 WP_012607879.1.40753 gi|390938033|ref|YP_006401771.1| gi|218883522|ref|YP_002427904.1| 490899.DKAM_0211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]