SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883570|ref|YP_002427952.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883570|ref|YP_002427952.1|
Domain Number 1 Region: 27-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-42
Family GHMP Kinase, N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 223-316,347-428
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.08e-22
Family Mevalonate kinase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883570|ref|YP_002427952.1|
Sequence length 440
Comment GHMP kinase [Desulfurococcus kamchatkensis 1221n]
Sequence
MGLIRITSKFKIQGVSSWRIWEDDFMIDKIGIAFKEFYGEKPSIVVSAPGRLDFLNTHQD
YKGLPVSAIGVNLRTYIALAPSNNGVMAYSENLNAVDEFHPEEITLRGGKWFGDYIRAVF
KVFTEEGYRIKGFKAYIASNIPIASGLASSAALEVAVAWGISELNGLGLSRKDIAEYAFK
AESKVMGIPCGRLDQYGSAFGGVTLIHTRPPYNVEELGFREGVWLVVDSGIRHSTADIHP
RVQGEIDRALNELMSIVPPGLKSKLGYRYWEPRWEELTLDELTPYLDNVNRTGARKIEFT
IRMHSSTMLAVKALKGFKPTVGEVVEVLGSELAEPEKVRSILSSNTWRLELIGLVMNHQH
YLLSKLYDVSLPEIDRIVDEMNKLGALGAKLSGAGLGGSVIALCRDRDTAGKALKGVLDC
CAPRGWIVEIDEGVKTHGDR
Download sequence
Identical sequences B8D2K4
gi|218883570|ref|YP_002427952.1| WP_012607927.1.40753 490899.DKAM_0259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]