SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883612|ref|YP_002427994.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883612|ref|YP_002427994.1|
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Single hybrid motif 7.59e-40
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883612|ref|YP_002427994.1|
Sequence length 146
Comment glycine cleavage system protein H [Desulfurococcus kamchatkensis 1221n]
Sequence
MVGYMSEVIVEVKGKKYVVKTDRRYTETDEWALLENGRIRVGISDYAQKELKDIVSVELP
EVGRVVRKGEELGIIDSIKASSSYYAPVSGRIVEVNEELSTTPELLNKDPYGAGWIIVIE
PSNPKEYEELYTPEKYSEKIRSGKQH
Download sequence
Identical sequences B8D3E6
gi|218883612|ref|YP_002427994.1| 490899.DKAM_0301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]