SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883688|ref|YP_002428070.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883688|ref|YP_002428070.1|
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.23e-26
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 145-251
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.96e-16
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883688|ref|YP_002428070.1|
Sequence length 258
Comment aldehyde oxidase and xanthine dehydrogenase family protein, middle subunit [Desulfurococcus kamchatkensis 1221n]
Sequence
MIRDRKIPVPKYLVDLSPLRRDLSYVVVENGVVRIGALTTLWELSKSILHQDIKYAGFID
VFRKFGTMAIRFNATIGGNIASATQYSDYITLLLVYDAELRLESVHGVRKVRLEEFLVDK
RKTILMPNEIITEISFKEPPSKTSSAFIKFDRRELLIAGIVTGAVYLTEEEGRIREARIA
FDMISEHRIPGRARSTEKCITGRNISEETLIEAEQCLDKEMKRISDWWATSEYRLEMSKA
ILRKGLRLVHNRILNGVM
Download sequence
Identical sequences B8D3M2
490899.DKAM_0377 gi|218883688|ref|YP_002428070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]