SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883841|ref|YP_002428223.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883841|ref|YP_002428223.1|
Domain Number 1 Region: 6-442
Classification Level Classification E-value
Superfamily L-aspartase-like 7.7e-104
Family L-aspartase/fumarase 0.0000000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883841|ref|YP_002428223.1|
Sequence length 447
Comment Adenylosuccinate lyase [Desulfurococcus kamchatkensis 1221n]
Sequence
MSGSICPLEWRYGSTEMRRVFSRRNIVDTYIAVEAAILKGLEEAGLAPSGCWSKVESLKG
TLDPAEVDRLESRIGHDIAAIAEIISNRIDEPCSRFVHLGATSYDIVDTTWALILGEALK
LTRARLIEVIKLLASLVEKYRDTIVVGRTHARHALPITFGFKMANYAYELTRSLQRLREL
NERVVRSKISGAVGTMAGWLKQGLIVENTASSHLGLKPHLITTQVAPRDGFAEVIADLAI
LASQLERLSLEVRELMRDEISEVYIDTGEVGSSAMPHKRNPSVPERVCGLSRVIRGLLVS
SMENIALMHERDLTNSSSERVIIPHVFLIIDQMLLDTISILRGLRVDEVSTSRNLELTQG
RIMSECIMVKLVLRKGYSRIQAHELLRKLSRESIRENKHLREILMENGLYDDEIGECFDY
SKYLGNYSELIDRVLKYVREQIEVGSM
Download sequence
Identical sequences B8D425
490899.DKAM_0530 gi|218883841|ref|YP_002428223.1| WP_012608198.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]