SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883910|ref|YP_002428292.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883910|ref|YP_002428292.1|
Domain Number 1 Region: 233-374
Classification Level Classification E-value
Superfamily vWA-like 0.0000731
Family Integrin A (or I) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218883910|ref|YP_002428292.1|
Sequence length 439
Comment hypothetical protein DKAM_0599 [Desulfurococcus kamchatkensis 1221n]
Sequence
MAIHATTRLRLYMLSTALLLAGAIIVDPTFLPPALLLLSLPVFSYIAIESNYKILKSIKV
SGSVAMETGGRFFVEYTIINPTRIPILPVEFSIQYSELIKLVKGSKRGLLIIPPRAKVKL
RFSFHGRLGEHFVGPLKIVLRDLFGFYRSSDEYLGKALVVNIPPTVEEVIVRKLLIYARS
TGLVKSRIPGEGVEFYDIRDYSPGDEAKRIVWRIYASRRMLAIWEPEKEVFQPVLFILDG
TREMWSGPMSQSMIEHSARIISSIIYYLVKRGYPVSATVFNESLVHTSGKPMHGYHGYME
ALRVLSKVKFEEGDESHRRRALSGVLSYTYTRILPRDRSIIFLFTHLRDTIIDEIAAWNN
LYKDKGHILYIVHPLITAYESDSDVPEWVANIYRVKLIENLREDMAVISRARGRGLKVIA
VTPDLIPQRVMDIIERYSS
Download sequence
Identical sequences B8D494
WP_012608266.1.40753 gi|218883910|ref|YP_002428292.1| 490899.DKAM_0599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]