SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883962|ref|YP_002428344.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883962|ref|YP_002428344.1|
Domain Number 1 Region: 70-334
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.18e-38
Family Alanine racemase-like, N-terminal domain 0.005
Further Details:      
 
Weak hits

Sequence:  gi|218883962|ref|YP_002428344.1|
Domain Number - Region: 538-577
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00977
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218883962|ref|YP_002428344.1|
Sequence length 592
Comment Orn/DAP/Arg decarboxylase 2 [Desulfurococcus kamchatkensis 1221n]
Sequence
MYEKEMNREEWDINVAKELWGLNHSIRGSIITVDEEGYLVISLGEQKIRVKNLLEKHGFD
VAYIRVLPLIERAIRTVYEAFTELAKVHGFKGSLQPVFPMKVNPIEVVIDAIWRYGEKYK
WGFNTGSLGELELLSKYLEKGGRILIYDGVVSDSVMKILVRFKENGWRVIIDVESEHDLD
ILSKYPEFEIGLRIKPLFRPGGKWAHSAGLEGKFGLTVNTLVKLREEYKWIEERGRLLHI
HPGSQIYKWSDMEAFINEVYNIFTQLQSHGFPSIEIVDLGGGLAYPYLDTRDGTIESPDY
GLIEYFNHILKIFSRLEKHPTLVYEGGRYIVSAHRILVAKVVDIRPYSTEQAQSLRSAQV
EDFLSNVRSIDDLKKLVNEYKKYIHKSKQVHQYTLEERELAEDVVSKVRDELLAKIYELV
RNKPSQIESVINDPLLYKLVTSPSKRYILNFSIFADIPDSVLVNQYFQAVPAQRLNEKPD
VLAVLGDLTCDSMGEINEYISHVKTPLEASDWFTKMDLRLMLIPGRRLKLGGVPLHLPIK
GENYYIAILDTGAYQDPLAMKHNLIYGAPEIILDEKDGEVEVKIIEKNGKYL
Download sequence
Identical sequences B8D4E6
490899.DKAM_0651 gi|218883962|ref|YP_002428344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]