SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218883992|ref|YP_002428374.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218883992|ref|YP_002428374.1|
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.27e-37
Family Transposase IS200-like 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218883992|ref|YP_002428374.1|
Sequence length 118
Comment IS element ISDka2 orfA [Desulfurococcus kamchatkensis 1221n]
Sequence
MWIPKYRRDILIGDVAEYTKEVLRGIITGIGCEPLAIEVMPDHVHVLLLCPPRLAPSYVA
NYLKGKSARLILKRFPQLRARVKYGKLWSRSYFVATVGNVTADIVKRYVEEQWSKVRE
Download sequence
Identical sequences B8D4H6
490899.DKAM_0681 gi|218883992|ref|YP_002428374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]