SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884059|ref|YP_002428441.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884059|ref|YP_002428441.1|
Domain Number 1 Region: 92-224
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.79e-20
Family Cytidylyltransferase 0.007
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily AF1782-like 3.14e-19
Family AF1782-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218884059|ref|YP_002428441.1|
Sequence length 229
Comment Glycerol-3-phosphate cytidylyltransferase [Desulfurococcus kamchatkensis 1221n]
Sequence
MTTLCDRVKAYIDNVEQVLQQATAIRELDPRHRYIIELACSYASDAKYYLEKNDCFTSLA
CIAYAEGLLDSLRYQNIISFNWKPLSELLKRPRVLVAGSFEFLHPGHIYLLKRAWELGEV
YVVVSRNRNFTRFKGREPIMDEKERLLIVENVKYVSKAIMGDEEDFLKPIVELKPDIVLL
GPDQWIQPDELKSLLEKKGLSNVRVEKLESRIGEWSSSRIIERIKNKYC
Download sequence
Identical sequences B8D4P3
gi|218884059|ref|YP_002428441.1| 490899.DKAM_0748 WP_012608415.1.1384 WP_012608415.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]