SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218884114|ref|YP_002428496.1| from Desulfurococcus kamchatkensis 1221n

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218884114|ref|YP_002428496.1|
Domain Number 1 Region: 2-236
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 3.67e-66
Family Purine and uridine phosphorylases 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218884114|ref|YP_002428496.1|
Sequence length 240
Comment purine and other phosphorylase, family 1 [Desulfurococcus kamchatkensis 1221n]
Sequence
MPIHIKASPGDIAENVIAVGDPGRVDILSGLLSNVKTVNIHRGFKIVTGLYNGEKVTIAT
HGVGAPSASIVFEELRQLGAKRIVRIGTTGGVRKDTRIGDVIVATGAAYTVNGCGLGQYM
PGICGAASPDPVLTTRIIESMEEHGIEYKKGPVFSSDAFYAEDPSFAERLSHYGIVAVEM
EAAALFALGWLRGFETACVLVVSDVLHGEEAMKKYLTTEELAEVFLKVAKLVLDVFHKYY
Download sequence
Identical sequences B8D4U8
WP_012608470.1.1384 WP_012608470.1.40753 490899.DKAM_0803 gi|218884114|ref|YP_002428496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]